SecReT4
Protein ID: 54293963
T4SS name [ID]Tfc [760]
Gene symbol-
Locus taglpl1020
StrainLegionella pneumophila str. Lens
Repliconchromosome [GenBank: NC_006369] [Browse all T4SS(s) in this replicon]
Location [Strand]1153450..1154817 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDQ5WXS1
KEGG IDlpf:lpl1020
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 455 a.a.     [Download]
>gi|54293963|ref|YP_126378.1| hypothetical protein lpl1020 [Legionella pneumophila str. Lens]
MKKYLLLALLVPTLTHAGSFMPSQSDYYYELGGTSNLFIPPVNKDQTLVIGADIDGRMGFSCSGFNPVVS
ITNTFQDLKKSALNIPGGVIDNLKGSVAGFPLYKLQQSMPALYNVLQNAASSAQNEFTLKVKDCQEVKQA
LEQNQSPMEGILSVSDSQGWLDAAKRAKKENVDVTETSKSIAQKRDEYGLPWIGSDKGNAGGKFQRPIKV
INDVVIAGYNILLERKPLDSLEKPSTKIPMVQSWPTPTDAANWAVKVLGDIQVSSSENKQSHDAKAGIGL
SALLQSCANANTCSQNIAKALWNLVNGTWTLTEENLRKVSASNLLITDEVITTIQHLPREEQMLTVSKLA
EEIAVQNMLDKALMMRRILQAGLQVQEVQNLKPAMNMVLFALKKLDDDIHSLSFENDVRKKMMTETVGTI
MDIRHQAQSQNIPGQDHEQPAVKNGAIYVKENKGA
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|54292964|ref|NC_006369.1|:c1154817-1153450 Legionella pneumophila str. Lens, complete genome
ATGAAAAAATATCTATTACTAGCTTTACTCGTTCCAACACTGACTCATGCTGGCAGCTTTATGCCTAGCC
AATCGGATTACTATTATGAATTAGGCGGAACCTCCAATTTATTTATTCCACCTGTTAATAAAGACCAAAC
GCTGGTTATTGGTGCAGATATTGATGGCCGTATGGGATTCTCCTGTAGCGGTTTTAATCCTGTCGTATCC
ATTACCAATACTTTTCAAGATTTGAAAAAATCAGCGTTAAACATCCCGGGTGGTGTCATTGATAACTTAA
AAGGTTCAGTCGCAGGATTCCCTCTTTATAAGCTACAACAGTCCATGCCTGCTTTGTACAATGTTCTACA
AAATGCCGCATCCAGCGCGCAAAATGAATTTACCCTCAAAGTTAAAGATTGTCAGGAAGTCAAACAAGCA
TTGGAACAAAACCAATCACCAATGGAAGGTATATTATCAGTCTCTGATAGTCAGGGATGGCTCGATGCTG
CCAAACGAGCTAAGAAGGAAAACGTCGATGTGACTGAAACATCGAAAAGTATTGCTCAAAAACGAGATGA
ATATGGTCTGCCCTGGATAGGTAGCGATAAAGGTAATGCTGGGGGTAAATTTCAACGTCCCATTAAGGTC
ATCAATGATGTGGTTATTGCTGGCTACAACATCCTTTTAGAGAGAAAACCCTTAGATTCTTTGGAAAAGC
CAAGTACCAAAATCCCTATGGTACAAAGCTGGCCAACACCTACCGATGCTGCTAATTGGGCAGTTAAGGT
TCTTGGCGATATTCAGGTCAGCAGCAGTGAGAACAAACAAAGCCATGATGCTAAAGCAGGTATTGGTTTA
TCAGCTCTATTGCAAAGCTGTGCGAACGCCAATACCTGTAGTCAGAACATTGCTAAAGCCTTATGGAATT
TGGTCAATGGTACTTGGACGCTGACCGAAGAAAATCTGAGAAAAGTCAGCGCTTCCAATTTGCTGATTAC
TGATGAAGTCATTACAACCATTCAGCATCTACCTCGTGAAGAACAGATGCTCACCGTTTCAAAACTAGCA
GAAGAAATCGCTGTTCAAAATATGCTGGATAAAGCGTTGATGATGCGCCGCATCTTGCAGGCAGGATTAC
AAGTGCAAGAAGTACAGAATTTAAAACCAGCTATGAATATGGTCTTGTTTGCCCTAAAAAAATTGGATGA
TGACATCCACTCTTTGTCCTTTGAAAACGATGTCCGTAAAAAAATGATGACTGAAACCGTGGGAACCATC
ATGGATATTCGACATCAAGCACAAAGCCAAAACATCCCAGGCCAGGATCACGAACAACCTGCTGTTAAAA
ACGGTGCAATCTATGTTAAAGAAAATAAAGGAGCTTAA
 Primer design