SecReT4
Protein ID: 54293970
T4SS name [ID]Tfc [760]
Gene symbol-
Locus taglpl1027
StrainLegionella pneumophila str. Lens
Repliconchromosome [GenBank: NC_006369] [Browse all T4SS(s) in this replicon]
Location [Strand]1161526..1161888 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDQ5WXR4
KEGG IDlpf:lpl1027
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.7e-09, Aligned region: 11..113
Protein Sequence: 120 a.a.     [Download]
>gi|54293970|ref|YP_126385.1| hypothetical protein lpl1027 [Legionella pneumophila str. Lens]
MSQPSSRHLSHDFPAWKGLSLRELFWIVITTTPVTTLLFILLGTMAGYPLAAGCIGFVIGFIFSITVWPK
GVARIKAGKPYGYVMKKTIQWMVRLRLKHSPWIHYQGQWQKNKSVGEPHV
 
Nucleotide Sequence: 363 bp     [Download]
>gi|54292964|ref|NC_006369.1|:c1161888-1161526 Legionella pneumophila str. Lens, complete genome
ATGAGTCAGCCTTCTTCGCGCCATCTATCACATGACTTTCCAGCCTGGAAAGGCTTAAGTCTGCGTGAAT
TGTTTTGGATTGTCATCACTACAACACCAGTAACTACCTTGCTTTTTATTCTTTTAGGAACAATGGCAGG
GTATCCACTAGCCGCTGGCTGCATCGGTTTTGTGATTGGATTCATCTTCTCCATTACCGTATGGCCAAAA
GGAGTCGCCCGTATCAAAGCAGGCAAACCTTATGGTTATGTGATGAAGAAAACCATTCAATGGATGGTGC
GATTAAGGCTCAAACACTCGCCCTGGATTCATTATCAGGGGCAGTGGCAAAAGAATAAATCTGTTGGAGA
GCCTCATGTTTGA
 Primer design