SecReT4
Protein ID: 54293973
T4SS name [ID]Tfc [760]
Gene symbol-
Locus taglpl1030
StrainLegionella pneumophila str. Lens
Repliconchromosome [GenBank: NC_006369] [Browse all T4SS(s) in this replicon]
Location [Strand]1162528..1162854 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDQ5WXR1
KEGG IDlpf:lpl1030
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 2.8e-05, Aligned region: 24..103
Protein Sequence: 108 a.a.     [Download]
>gi|54293973|ref|YP_126388.1| hypothetical protein lpl1030 [Legionella pneumophila str. Lens]
MKRLLCLTLIMISLQCSANNPDLNETLVRIINQINAIMPLLDEAQTQVTPNARIQLQIEGFEDLQGQHHS
GLREDLLNIRNGLIDYINQPIIAPRKIKPLEMDFVRKP
 
Nucleotide Sequence: 327 bp     [Download]
>gi|54292964|ref|NC_006369.1|:c1162854-1162528 Legionella pneumophila str. Lens, complete genome
ATGAAACGATTGCTTTGTTTGACCTTGATAATGATAAGCCTTCAATGCTCAGCAAATAACCCTGATTTAA
ATGAAACTTTGGTGCGCATCATTAATCAGATTAACGCCATCATGCCTTTGCTTGATGAAGCGCAAACACA
AGTAACACCTAATGCTCGTATCCAATTGCAAATAGAAGGATTTGAAGACCTCCAAGGCCAGCATCACTCC
GGATTGAGAGAAGACTTGCTAAATATCCGCAACGGCCTGATTGACTACATCAACCAGCCCATCATTGCCC
CTCGAAAAATTAAACCATTAGAAATGGATTTTGTGAGGAAACCTTAA
 Primer design