SecReT4
Protein ID: 54293974
T4SS name [ID]Tfc [760]
Gene symbol-
Locus taglpl1031
StrainLegionella pneumophila str. Lens
Repliconchromosome [GenBank: NC_006369] [Browse all T4SS(s) in this replicon]
Location [Strand]1162864..1163496 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDQ5WXR0
KEGG IDlpf:lpl1031
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 7.5e-43, Aligned region: 87..207
Protein Sequence: 210 a.a.     [Download]
>gi|54293974|ref|YP_126389.1| hypothetical protein lpl1031 [Legionella pneumophila str. Lens]
MAVKQYSRQLTMQLTIVLFLGWLAIIIWALSQWMLHGYPIAFEKVNILVNTQREAISPVYQGSLLAVLPL
NAKPDWALAIPYVNKLVINDLAKDLIEKSQQFLQILLLSSQCLLIKLIILFAALPLFALTMIAGLVDGLN
QRAIRTACLGRESSYVFHRLNHYLKKGLVILLMLWLALPVSITPAYVFVPISLLMGLMVAMTASRFKKYL
 
Nucleotide Sequence: 633 bp     [Download]
>gi|54292964|ref|NC_006369.1|:c1163496-1162864 Legionella pneumophila str. Lens, complete genome
ATGGCAGTAAAGCAATATTCAAGGCAACTGACCATGCAATTAACCATAGTGCTATTCTTAGGTTGGTTAG
CAATTATTATCTGGGCATTGAGCCAATGGATGCTGCATGGCTACCCCATCGCTTTTGAAAAAGTGAATAT
CCTTGTAAACACTCAAAGAGAGGCTATTAGTCCTGTTTATCAAGGCTCCCTTCTGGCAGTCCTTCCTTTA
AATGCCAAACCAGATTGGGCATTAGCCATTCCTTACGTAAACAAATTGGTCATTAATGATCTTGCCAAGG
ATTTAATCGAAAAATCACAACAATTCTTGCAAATCCTTTTATTAAGCAGCCAGTGCCTTTTAATCAAACT
CATTATCTTATTCGCTGCCCTGCCCTTATTTGCTTTAACCATGATTGCAGGTCTGGTTGACGGACTAAAT
CAAAGAGCGATACGCACTGCTTGTTTAGGCCGTGAATCCTCTTATGTGTTTCACAGGCTTAATCACTATT
TAAAAAAGGGTCTTGTGATTTTACTTATGCTGTGGCTTGCCCTGCCCGTCAGCATCACCCCTGCTTATGT
TTTTGTTCCTATCAGTTTATTGATGGGGTTAATGGTAGCGATGACGGCCAGCCGTTTTAAGAAGTATTTA
TAG
 Primer design