SecReT4
Protein ID: 54295866
T4SS name [ID]Tra_F [510]
Gene symbol-
Locus tagplpp0023
StrainLegionella pneumophila str. Paris
Repliconplasmid pLPP [GenBank: NC_006365] [Browse all T4SS(s) in this replicon]
Location [Strand]19026..19316 [+]
Producthypothetical protein
Component typeTraL_F
UniProt IDQ5WSC3
KEGG IDlpp:plpp0023
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 3e-07, Aligned region: 10..95
Protein Sequence: 96 a.a.     [Download]
>gi|54295866|ref|YP_122178.1| hypothetical protein plpp0023 [Legionella pneumophila str. Paris]
MSHNYSTFMLSEEPRIAGIPLTTGLPVYLLTGIGLLIGYAPQLFVIGAVLSLIMHVQFGGLPLRVLLGII
YWSLPHAITTLIFRSFPNSAHRIYVG
 
Nucleotide Sequence: 291 bp     [Download]
>gi|54295843|ref|NC_006365.1|:19026-19316 Legionella pneumophila str. Paris plasmid pLPP, complete sequence
ATGTCGCATAACTATTCCACATTTATGTTGTCAGAGGAGCCACGTATAGCAGGGATTCCTTTGACCACTG
GATTACCCGTGTATTTGCTCACGGGTATTGGATTACTAATCGGTTATGCACCGCAGCTTTTTGTGATTGG
GGCCGTTTTAAGTTTAATCATGCATGTTCAGTTTGGTGGGCTGCCTTTACGGGTTTTATTAGGAATTATT
TATTGGTCCTTACCGCATGCCATAACGACGCTTATTTTTAGGTCATTCCCTAATTCCGCGCATCGAATCT
ACGTGGGGTGA
 Primer design