SecReT4
Protein ID: 54295877
T4SS name [ID]Tra_F [510]
Gene symbol-
Locus tagplpp0034
StrainLegionella pneumophila str. Paris
Repliconplasmid pLPP [GenBank: NC_006365] [Browse all T4SS(s) in this replicon]
Location [Strand]29312..30100 [+]
Producthypothetical protein
Component typeTraF_F
UniProt IDQ5WSB2
KEGG IDlpp:plpp0034
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 8.6e-55, Aligned region: 28..246
Protein Sequence: 262 a.a.     [Download]
>gi|54295877|ref|YP_122189.1| hypothetical protein plpp0034 [Legionella pneumophila str. Paris]
MSRLLMLMVWGLFVTSLHADIVQEHAKGFHWYSVEEAPKPIKKTLQPRPAPVVKSPYERLMDKRKETLNK
LAEALIAPSFNATHEYMKAQMDYSKNNQQFVRYWQQVLLVHPELDSTLNFPTDNSAIAVRNDAQKVLINK
VIQESSVRYGFILFYRGTSSISQKMVMHLLPFIKEYGFSMISVSTDGQLIDGLPNPKSIPLETVQKQVAL
EAKYMPALYFVDLKSNKMSPVSYGFLSLEELKQRIFDVMTQFKRFSYEGVNE
 
Nucleotide Sequence: 789 bp     [Download]
>gi|54295843|ref|NC_006365.1|:29312-30100 Legionella pneumophila str. Paris plasmid pLPP, complete sequence
ATGAGTCGCCTGTTGATGCTGATGGTATGGGGACTGTTCGTGACATCGCTTCATGCGGACATTGTGCAGG
AGCATGCAAAAGGCTTTCATTGGTATAGCGTTGAAGAGGCTCCCAAACCGATTAAAAAAACACTGCAGCC
ACGACCTGCTCCGGTGGTGAAATCTCCTTATGAGCGCTTAATGGATAAGCGTAAGGAAACTCTGAATAAA
CTGGCAGAGGCTTTGATTGCGCCATCTTTTAATGCAACGCACGAGTATATGAAAGCGCAAATGGATTATT
CAAAAAATAATCAGCAATTTGTGCGCTATTGGCAACAAGTTTTATTGGTCCATCCTGAATTGGATAGCAC
ACTTAATTTTCCAACCGATAACTCAGCGATTGCAGTACGCAATGATGCACAAAAAGTATTAATCAACAAA
GTCATTCAAGAAAGCAGTGTGCGTTATGGCTTTATCTTATTTTATCGTGGCACGAGCTCCATTTCACAAA
AAATGGTCATGCATTTGCTTCCCTTTATTAAAGAATATGGTTTTTCCATGATCTCAGTCAGTACGGATGG
CCAACTCATTGATGGGCTTCCTAATCCTAAATCAATTCCTCTGGAAACGGTTCAAAAACAAGTAGCACTT
GAGGCGAAGTACATGCCCGCTCTTTATTTTGTGGATTTAAAGAGCAACAAGATGTCGCCAGTGTCTTACG
GGTTTTTATCTTTAGAAGAGCTGAAGCAGCGCATTTTTGATGTGATGACGCAGTTTAAACGGTTTAGTTA
TGAAGGAGTGAATGAATGA
 Primer design