SecReT4
Protein ID: 54297016
T4SS name [ID]Tfc [762]
Gene symbol-
Locus taglpp1058
StrainLegionella pneumophila str. Paris
Repliconchromosome [GenBank: NC_006368] [Browse all T4SS(s) in this replicon]
Location [Strand]1181517..1182884 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDQ5X6A9
KEGG IDlpp:lpp1058
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 455 a.a.     [Download]
>gi|54297016|ref|YP_123385.1| hypothetical protein lpp1058 [Legionella pneumophila str. Paris]
MKKYLLLALLVPTLTHAGSFMPSQSDYYYELGGTSNLFIPPVNKDQTLVIGADIDGRMGFSCSGFNPVVS
ITNTFQDLKKSALNIPGGVIDNLKGSVAGFPLYKLQQSMPALYNVLQNAASSAQNEFTLKVKDCQEVKQA
LEQNQSPMEGILSVSDSQGWLDAAKRAKKENVDVTETSKSIAQKRDEYGLPWIGSDKGNAGGKFQRPIKV
INDVVIAGYNILLERKPLDSLEKPSTKIPMVQSWPTPTDAANWAVKVLGDIQVSSSENKQSHDAKAGIGL
SALLQSCANANTCSQNIAKALWNLVNGTWTLTEENLRKVSASNLLITDEVITTIQHLPREEQMLTVSKLA
EEIAVQNMLDKALMMRRILQAGLQVQEVQNLKPAMNMVLFALKKLDDDIHSLSFENDVRKKMMTETVGTI
MDIRHQAQSQNIPGQDHEQPAVKNGAIYVKENKGA
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|54295983|ref|NC_006368.1|:c1182884-1181517 Legionella pneumophila str. Paris, complete genome
ATGAAAAAATATCTATTACTAGCTTTACTCGTTCCAACACTGACTCATGCTGGCAGCTTTATGCCTAGCC
AATCGGATTACTATTATGAATTAGGCGGAACCTCCAATTTATTTATTCCACCTGTTAATAAAGACCAAAC
GCTGGTTATTGGTGCAGATATTGATGGCCGTATGGGATTCTCCTGTAGCGGTTTTAATCCTGTCGTATCC
ATTACCAATACTTTTCAAGATTTGAAAAAATCAGCGTTAAACATCCCGGGTGGTGTCATTGATAACTTAA
AAGGTTCAGTCGCAGGATTCCCTCTTTATAAGCTACAACAGTCCATGCCTGCTTTGTACAATGTTCTACA
AAATGCCGCATCCAGCGCGCAAAATGAATTTACCCTCAAAGTTAAAGATTGTCAGGAAGTCAAACAAGCA
TTGGAACAAAACCAATCACCAATGGAAGGTATATTATCAGTCTCTGATAGTCAGGGATGGCTCGATGCTG
CCAAACGAGCTAAGAAGGAAAACGTCGATGTGACTGAAACATCGAAAAGTATTGCTCAAAAACGAGATGA
ATATGGTCTGCCCTGGATAGGTAGCGATAAAGGTAATGCTGGGGGTAAATTTCAACGTCCCATTAAGGTC
ATCAATGATGTGGTTATTGCTGGCTACAACATCCTTTTAGAGAGAAAACCCTTAGATTCTTTGGAAAAGC
CAAGTACCAAAATCCCTATGGTACAAAGCTGGCCAACACCTACCGATGCTGCTAATTGGGCAGTTAAGGT
TCTTGGCGATATTCAGGTCAGCAGCAGTGAGAACAAACAAAGCCATGATGCTAAAGCAGGTATTGGTTTA
TCAGCTCTATTGCAAAGCTGTGCGAACGCCAATACCTGTAGTCAGAACATTGCTAAAGCCTTATGGAATT
TGGTCAATGGTACTTGGACGCTGACCGAAGAAAATCTGAGAAAAGTCAGCGCTTCCAATTTGCTGATTAC
TGATGAAGTCATTACAACCATTCAGCATCTACCTCGTGAAGAACAGATGCTCACCGTTTCAAAACTAGCA
GAAGAAATCGCTGTTCAAAATATGCTGGATAAAGCGTTGATGATGCGCCGCATCTTGCAGGCAGGATTAC
AAGTGCAAGAAGTACAGAATTTAAAACCAGCTATGAATATGGTCTTGTTTGCCCTAAAAAAATTGGATGA
TGACATCCACTCTTTGTCCTTTGAAAACGATGTCCGTAAAAAAATGATGACTGAAACCGTGGGAACCATC
ATGGATATTCGACATCAAGCACAAAGCCAAAACATCCCAGGCCAGGATCACGAACAACCTGCTGTTAAAA
ACGGTGCAATCTATGTTAAAGAAAATAAAGGAGCTTAA
 Primer design