SecReT4
Protein ID: 54297023
T4SS name [ID]Tfc [762]
Gene symbol-
Locus taglpp1065
StrainLegionella pneumophila str. Paris
Repliconchromosome [GenBank: NC_006368] [Browse all T4SS(s) in this replicon]
Location [Strand]1189593..1189955 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDQ5X6A2
KEGG IDlpp:lpp1065
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.7e-09, Aligned region: 11..113
Protein Sequence: 120 a.a.     [Download]
>gi|54297023|ref|YP_123392.1| hypothetical protein lpp1065 [Legionella pneumophila str. Paris]
MSQPSSRHLSHDFPAWKGLSLRELFWIVITTTPVTTLLFILLGTMAGYPLAAGCIGFVIGFIFSITVWPK
GVARIKAGKPYGYVMKKTIQWMVRLRLKHSPWIHYQGQWQKNKSVGEPHV
 
Nucleotide Sequence: 363 bp     [Download]
>gi|54295983|ref|NC_006368.1|:c1189955-1189593 Legionella pneumophila str. Paris, complete genome
ATGAGTCAGCCTTCTTCGCGCCATCTATCACATGACTTTCCAGCCTGGAAAGGCTTAAGTCTGCGTGAAT
TGTTTTGGATTGTCATCACTACAACACCAGTAACTACCTTGCTTTTTATTCTTTTAGGAACAATGGCAGG
GTATCCACTAGCCGCTGGCTGCATCGGTTTTGTGATTGGATTCATCTTCTCCATTACCGTATGGCCAAAA
GGAGTCGCCCGTATCAAAGCAGGCAAACCTTATGGTTATGTGATGAAGAAAACCATTCAATGGATGGTGC
GATTAAGGCTCAAACACTCGCCCTGGATTCATTATCAGGGACAGTGGCAAAAGAATAAATCTGTTGGAGA
GCCTCATGTTTGA
 Primer design