SecReT4
Protein ID: 54297026
T4SS name [ID]Tfc [762]
Gene symbol-
Locus taglpp1068
StrainLegionella pneumophila str. Paris
Repliconchromosome [GenBank: NC_006368] [Browse all T4SS(s) in this replicon]
Location [Strand]1190595..1190921 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDQ5X699
KEGG IDlpp:lpp1068
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 2.3e-05, Aligned region: 24..103
Protein Sequence: 108 a.a.     [Download]
>gi|54297026|ref|YP_123395.1| hypothetical protein lpp1068 [Legionella pneumophila str. Paris]
MKRLLCLTLIMISLQCSANNPDLNETLVRIINQINAIMPLLDEAQTQVTPNARIQLQIEGFEDLQGQHHA
GLREDLLNIRNGLIDYINQPIIAPRKIKPLEMDFVRKP
 
Nucleotide Sequence: 327 bp     [Download]
>gi|54295983|ref|NC_006368.1|:c1190921-1190595 Legionella pneumophila str. Paris, complete genome
ATGAAACGATTGCTTTGTTTGACCTTGATAATGATAAGCCTTCAATGCTCAGCAAATAACCCTGATTTAA
ATGAAACTTTGGTGCGCATCATTAATCAGATTAACGCCATCATGCCTTTGCTTGATGAAGCGCAAACACA
AGTAACACCTAATGCTCGTATCCAATTGCAAATAGAAGGATTTGAAGACCTCCAAGGCCAGCATCACGCA
GGATTGAGAGAAGACTTGCTAAATATCCGCAACGGCCTGATTGACTATATCAACCAGCCCATCATTGCCC
CTCGAAAAATTAAACCATTAGAAATGGATTTTGTGAGGAAACCCTAA
 Primer design