SecReT4
Protein ID: 54297027
T4SS name [ID]Tfc [762]
Gene symbol-
Locus taglpp1069
StrainLegionella pneumophila str. Paris
Repliconchromosome [GenBank: NC_006368] [Browse all T4SS(s) in this replicon]
Location [Strand]1190931..1191563 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDQ5X698
KEGG IDlpp:lpp1069
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 5.1e-43, Aligned region: 87..207
Protein Sequence: 210 a.a.     [Download]
>gi|54297027|ref|YP_123396.1| hypothetical protein lpp1069 [Legionella pneumophila str. Paris]
MAVKQYSRQLTMQLTIVLFLGWLAIIIWALSQWMLHGYPIAFEKVNILVNTQREAISPVYQGSLLAVLPL
NAKPDWALAIPYVNKLAINDLAKDLIEKSQQFLQILLLSSQCLLIKLIILFAALPLFALTMIAGLVDGLN
QRAIRTACLGRESSYVFHRLNHYLKKGLVILLMLWLALPVSITPAYVFVPISLLMGLMVAMTASRFKKYL
 
Nucleotide Sequence: 633 bp     [Download]
>gi|54295983|ref|NC_006368.1|:c1191563-1190931 Legionella pneumophila str. Paris, complete genome
ATGGCAGTAAAGCAATATTCAAGGCAACTGACCATGCAATTAACCATAGTGCTATTCTTAGGTTGGTTAG
CAATTATTATCTGGGCATTGAGCCAATGGATGCTGCATGGCTACCCCATCGCTTTTGAAAAAGTGAATAT
CCTTGTAAACACTCAAAGAGAGGCTATTAGTCCTGTTTATCAAGGCTCCCTTCTGGCAGTCCTTCCTTTA
AATGCCAAACCAGATTGGGCATTAGCCATTCCTTACGTAAACAAATTGGCCATTAATGATCTTGCCAAGG
ATTTAATCGAAAAATCACAACAATTCTTGCAAATCCTTTTATTAAGCAGCCAGTGCCTTTTAATCAAACT
CATTATCTTATTCGCTGCCCTGCCCTTATTTGCTTTAACCATGATTGCAGGTCTGGTTGACGGACTAAAT
CAAAGAGCGATACGCACTGCTTGTTTAGGCCGTGAATCCTCTTATGTGTTTCACAGGCTTAATCACTATT
TAAAAAAGGGTCTTGTGATTTTACTTATGCTGTGGCTTGCCCTGCCCGTCAGCATCACCCCTGCTTATGT
TTTTGTTCCTATCAGTTTATTGATGGGGTTAATGGTAGCGATGACGGCCAGCCGTTTTAAGAAGTATTTA
TAG
 Primer design