SecReT4
Protein ID: 54298324
T4SS name [ID]Tfc [763]
Gene symbol-
Locus taglpp2383
StrainLegionella pneumophila str. Paris
Repliconchromosome [GenBank: NC_006368] [Browse all T4SS(s) in this replicon]
Location [Strand]2729924..2730622 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDQ5X2K5
KEGG IDlpp:lpp2383
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1.8e-51, Aligned region: 39..229
Protein Sequence: 232 a.a.     [Download]
>gi|54298324|ref|YP_124693.1| hypothetical protein lpp2383 [Legionella pneumophila str. Paris]
MAIRTATPKPSKKTVMSFMLLVLLGWLILMGWVSSLWCCLGFEKAFSSVTTLSQKQTQAITAFNGVMVAN
TIKSWLKTIPTQGVANKAAQTGSLIKKGLDEVMPDETNDLNEIAQDFILIANQVWLLMGLTTQVMFIKLV
ILISAIPLFLLMTVVGLVDGLNQRAIRTASLGRESSYVFHQLNRHAKRGLLLLLSLWLALPISITPAFVF
VPASLLLGIMVSITASRFKKYL
 
Nucleotide Sequence: 699 bp     [Download]
>gi|54295983|ref|NC_006368.1|:2729924-2730622 Legionella pneumophila str. Paris, complete genome
ATGGCAATAAGGACTGCAACGCCCAAACCCTCCAAAAAAACGGTCATGAGTTTTATGCTGCTTGTTTTAT
TGGGCTGGTTAATCCTTATGGGTTGGGTATCCAGTCTTTGGTGCTGTTTAGGGTTTGAAAAAGCGTTTAG
TTCAGTTACCACACTTTCTCAAAAACAAACGCAAGCAATTACCGCATTTAACGGAGTGATGGTTGCTAAC
ACTATTAAATCCTGGTTAAAAACCATTCCTACTCAAGGTGTTGCCAACAAAGCGGCGCAAACAGGCTCCC
TGATTAAAAAAGGGCTGGATGAGGTGATGCCTGATGAAACCAATGACTTAAATGAAATAGCACAAGATTT
TATCCTAATTGCCAATCAAGTTTGGTTACTGATGGGATTAACTACTCAAGTGATGTTCATCAAATTGGTT
ATTTTGATTTCAGCTATCCCTTTGTTTTTATTAATGACCGTGGTTGGACTTGTTGATGGATTAAATCAAC
GCGCTATCCGTACCGCATCATTAGGCCGTGAATCATCCTATGTCTTTCACCAACTCAATCGCCACGCCAA
GCGAGGCCTTTTATTGTTATTAAGCTTATGGCTTGCACTGCCCATAAGCATCACGCCTGCCTTTGTTTTT
GTACCTGCAAGCCTATTGTTAGGCATCATGGTTTCAATCACCGCAAGTCGATTTAAAAAATATTTGTAG
 Primer design