SecReT4
Protein ID: 54298325
T4SS name [ID]Tfc [763]
Gene symbol-
Locus taglpp2384
StrainLegionella pneumophila str. Paris
Repliconchromosome [GenBank: NC_006368] [Browse all T4SS(s) in this replicon]
Location [Strand]2730632..2730958 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDQ5X2K4
KEGG IDlpp:lpp2384
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 108 a.a.     [Download]
>gi|54298325|ref|YP_124694.1| hypothetical protein lpp2384 [Legionella pneumophila str. Paris]
MKRRLLLLLILSLPMTSHASDDALNQTLVRIINQINAIMPLLDEAKTEIEPNTRIQLHIEHFEGSDGKTH
AGLRTDLLSIRNALIDYINKPAIEPKTIKPLALDFIGK
 
Nucleotide Sequence: 327 bp     [Download]
>gi|54295983|ref|NC_006368.1|:2730632-2730958 Legionella pneumophila str. Paris, complete genome
ATGAAACGACGATTATTGTTATTACTCATATTAAGTCTGCCAATGACCTCTCATGCGAGTGACGATGCAC
TCAACCAAACGCTGGTCAGAATAATTAATCAGATTAATGCCATCATGCCTTTGCTTGATGAAGCAAAAAC
TGAAATTGAACCCAATACCCGCATCCAATTGCATATAGAACATTTTGAAGGCTCTGATGGAAAGACACAC
GCAGGCCTTCGTACCGATTTACTGTCCATTCGTAATGCGCTGATTGATTACATCAATAAACCAGCCATTG
AACCTAAAACCATCAAGCCGTTAGCGTTGGATTTTATAGGAAAATGA
 Primer design