SecReT4
Protein ID: 54298328
T4SS name [ID]Tfc [763]
Gene symbol-
Locus taglpp2387
StrainLegionella pneumophila str. Paris
Repliconchromosome [GenBank: NC_006368] [Browse all T4SS(s) in this replicon]
Location [Strand]2731622..2731972 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDQ5X2K1
KEGG IDlpp:lpp2387
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.7e-09, Aligned region: 16..113
Protein Sequence: 116 a.a.     [Download]
>gi|54298328|ref|YP_124697.1| hypothetical protein lpp2387 [Legionella pneumophila str. Paris]
MNQPSSRHLSFDYEAYKGLSLRELFWIVVVTTPLISMGCTLAGLFIGYPLAFGCIGFIVGFIVSITFCPK
RAAAIKAGKPHGYLMKKTVLLMAKWGLRHSPYIHHQGVWQKSRLVR
 
Nucleotide Sequence: 351 bp     [Download]
>gi|54295983|ref|NC_006368.1|:2731622-2731972 Legionella pneumophila str. Paris, complete genome
ATGAATCAACCATCCTCACGTCATCTGTCGTTTGATTATGAAGCCTATAAAGGGTTAAGCCTAAGAGAGC
TTTTCTGGATAGTGGTGGTAACAACACCACTAATTAGCATGGGATGTACTTTGGCAGGACTTTTTATTGG
CTATCCGTTGGCCTTCGGATGTATTGGTTTCATTGTTGGTTTTATTGTGTCCATTACTTTTTGCCCTAAA
CGGGCAGCTGCCATTAAGGCTGGTAAACCGCATGGCTATTTAATGAAAAAAACCGTGTTGTTGATGGCAA
AGTGGGGTTTAAGACACTCGCCCTACATTCACCATCAAGGTGTCTGGCAAAAATCAAGACTCGTGAGGTA
G
 Primer design