SecReT4
Protein ID: 54298335
T4SS name [ID]Tfc [763]
Gene symbol-
Locus taglpp2394
StrainLegionella pneumophila str. Paris
Repliconchromosome [GenBank: NC_006368] [Browse all T4SS(s) in this replicon]
Location [Strand]2738829..2740211 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDQ5X2J4
KEGG IDlpp:lpp2394
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 460 a.a.     [Download]
>gi|54298335|ref|YP_124704.1| hypothetical protein lpp2394 [Legionella pneumophila str. Paris]
MHKLSLSLLALILPKVLLASSFMPNESDYYYKLGGSSNLYVPPVNNDQTITIGGNVDGRLGFTCNGFNPV
VSITNTFQDMKSSAMNIPGGIIDNLKGSVAGFPLYKLQQSMPALYNVLQNTASYAQNEFSVKVKDCQDVK
KTLEEGQSPMESMLSVSDSQGWLEAAKRAKTENVDVTSTAKSIAKKRDEYGLPWIGRESGNAGGTYQRPI
KVINDVVIAGYNILLNRKPLNNEKKPDTKTPMTHTWPTPVDASQWAVKVLGDIHVSTATDADKTKHDTKA
GIGLSALLQSCDSSNTCTSNVSKALWNLVDKQWPLTEEKLKMVSASNLMITDEIIITIQRMPREEQILTV
SKLAEEIAVQNMLDKALMMRRILQAGLQVQEVQNLKPALDMVKFALKKLDDDIHSLAFESEVRKKMMTET
LGLLMDMRGSDIAKGLPGDDHEQSQVKNGAVYAKPDSKGA
 
Nucleotide Sequence: 1383 bp     [Download]
>gi|54295983|ref|NC_006368.1|:2738829-2740211 Legionella pneumophila str. Paris, complete genome
ATGCACAAACTGTCTCTTTCTTTACTTGCACTCATATTACCTAAAGTACTCTTAGCCAGTTCTTTTATGC
CTAATGAATCGGATTATTATTACAAGTTGGGTGGATCATCCAATCTATATGTACCTCCTGTCAATAATGA
CCAAACCATTACTATTGGCGGTAATGTCGATGGACGGCTTGGTTTTACCTGTAACGGGTTTAATCCTGTA
GTCTCCATTACCAATACATTTCAGGATATGAAGTCTTCTGCCATGAATATTCCTGGCGGTATTATTGATA
ACCTCAAAGGATCTGTTGCAGGATTTCCGCTGTATAAGCTACAACAATCCATGCCTGCGCTTTATAACGT
ACTGCAAAATACGGCCAGTTACGCGCAGAATGAATTTAGTGTTAAAGTCAAAGACTGCCAGGATGTGAAG
AAGACCTTGGAAGAAGGCCAATCGCCTATGGAAAGCATGCTTTCTGTGTCTGATAGTCAAGGCTGGCTTG
AAGCAGCAAAACGGGCGAAAACTGAAAATGTGGATGTGACTTCAACGGCTAAAAGTATTGCCAAAAAACG
TGACGAATATGGACTGCCCTGGATAGGACGGGAAAGCGGGAATGCCGGTGGAACATACCAACGTCCTATC
AAAGTCATTAACGATGTAGTCATTGCGGGTTACAACATTTTACTGAATCGCAAACCGCTTAATAATGAGA
AAAAACCGGATACCAAAACACCCATGACACATACTTGGCCAACACCTGTTGATGCCAGTCAATGGGCAGT
TAAAGTATTAGGCGATATTCATGTAAGCACCGCTACAGATGCAGATAAAACCAAACATGATACCAAGGCT
GGCATTGGGTTATCCGCGTTATTACAAAGTTGTGACAGCTCCAATACCTGTACATCCAATGTGTCTAAAG
CACTGTGGAATCTAGTAGACAAGCAATGGCCGTTGACTGAAGAAAAACTCAAAATGGTTAGTGCATCCAA
CTTGATGATTACAGATGAAATCATCATCACCATACAACGTATGCCGCGGGAAGAACAAATCTTAACTGTT
TCCAAATTGGCCGAGGAAATTGCTGTACAAAACATGCTCGATAAGGCCTTGATGATGCGCCGTATTTTAC
AAGCTGGTCTTCAAGTACAAGAAGTACAAAACTTAAAGCCCGCGCTTGATATGGTGAAATTTGCCTTAAA
GAAACTCGATGATGACATTCATTCTTTAGCTTTTGAAAGCGAAGTCCGTAAAAAAATGATGACTGAAACC
TTAGGTCTTTTGATGGATATGCGAGGTAGCGATATAGCCAAGGGCTTGCCTGGTGATGATCATGAACAAT
CGCAAGTTAAAAATGGCGCAGTCTATGCGAAACCTGATTCCAAAGGAGCATAA
 Primer design