SecReT4
Protein ID: 54303265
T4SS name [ID]Trb [241]
Gene symbol-
Locus tagPBPRB1598
StrainPhotobacterium profundum SS9
Repliconchromosome 2 [GenBank: NC_006371] [Browse all T4SS(s) in this replicon]
Location [Strand]1748085..1748420 [+]
Productconjugal transfer protein, TrbC
Component typeTrbC
UniProt IDQ6LGX2
KEGG IDppr:PBPRB1598
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 6.8e-19, Aligned region: 5..101
Protein Sequence: 111 a.a.     [Download]
>gi|54303265|ref|YP_133258.1| conjugal transfer protein, TrbC [Photobacterium profundum SS9]
MRCKQWRQQWSQVWLKANIAVFGFMPFLAQASNTGMPYESPLEKVVNSITGPVAFGASVLGIVAAGIGLI
FGGEMNGFIQRLMILSLVISVIVMATNLMSFLFNVSSTLVI
 
Nucleotide Sequence: 336 bp     [Download]
>gi|54301680|ref|NC_006371.1|:1748085-1748420 Photobacterium profundum SS9 chromosome 2, complete sequence
ATGCGATGTAAACAATGGCGCCAACAATGGTCACAGGTTTGGCTTAAAGCCAATATTGCCGTATTCGGCT
TCATGCCCTTTCTGGCACAGGCCTCCAACACCGGCATGCCCTACGAATCCCCGTTAGAGAAAGTGGTGAA
CTCCATCACTGGCCCCGTCGCGTTTGGCGCCTCTGTCTTGGGGATTGTGGCCGCTGGCATTGGCCTGATT
TTTGGCGGGGAAATGAATGGGTTTATCCAAAGATTAATGATCCTCTCATTGGTCATTTCCGTCATCGTCA
TGGCCACGAACTTAATGTCATTTTTGTTCAATGTGTCTTCAACGCTGGTTATTTAG
 Primer design