SecReT4
Protein ID: 54303266
T4SS name [ID]Trb [241]
Gene symbol-
Locus tagPBPRB1599
StrainPhotobacterium profundum SS9
Repliconchromosome 2 [GenBank: NC_006371] [Browse all T4SS(s) in this replicon]
Location [Strand]1748431..1748724 [+]
Productmating pair formation protein TrbD
Component typeTrbD
UniProt IDQ6LGX1
KEGG IDppr:PBPRB1599
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 1.4e-17, Aligned region: 11..89
Protein Sequence: 97 a.a.     [Download]
>gi|54303266|ref|YP_133259.1| mating pair formation protein TrbD [Photobacterium profundum SS9]
MNTDEPLVCRPVFAFNRSHLFLGGERELVLSMVLLCIVLIVALQNIYTAMMGVVLLIVSITVARMMAKSD
PQLTKTYRRFARYQRFYPSNGMKQYGG
 
Nucleotide Sequence: 294 bp     [Download]
>gi|54301680|ref|NC_006371.1|:1748431-1748724 Photobacterium profundum SS9 chromosome 2, complete sequence
ATGAATACTGACGAACCGTTAGTCTGCCGCCCTGTATTTGCGTTTAACCGCAGCCATTTGTTCCTGGGCG
GAGAGCGCGAATTAGTCCTGAGTATGGTGCTGTTGTGTATCGTATTGATTGTGGCCCTGCAAAACATCTA
TACCGCCATGATGGGCGTTGTGTTGCTCATTGTATCCATCACGGTGGCCCGCATGATGGCCAAATCCGAT
CCGCAATTAACCAAAACATACCGCCGCTTTGCACGGTACCAACGGTTCTATCCGTCAAACGGCATGAAAC
AGTACGGGGGATAA
 Primer design