SecReT4
Protein ID: 54303267
T4SS name [ID]Trb [241]
Gene symbol-
Locus tagPBPRB1600
StrainPhotobacterium profundum SS9
Repliconchromosome 2 [GenBank: NC_006371] [Browse all T4SS(s) in this replicon]
Location [Strand]1748726..1751122 [+]
Productmating pair formation protein TrbE
Component typeTrbE
UniProt IDQ6LGX0
KEGG IDppr:PBPRB1600
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 9.1e-33, Aligned region: 453..723
CagE_TrbE_VirB [PF03135], Evalue: 4.5e-17, Aligned region: 180..395
DUF87 [PF01935], Evalue: 7.2e-05, Aligned region: 453..488
Protein Sequence: 798 a.a.     [Download]
>gi|54303267|ref|YP_133260.1| mating pair formation protein TrbE [Photobacterium profundum SS9]
MFNLKSYRDTQQGTPDLLNWAAMVDNGVMLNKDGSFTAAWTYTGLDAATATNTDRNDAVYRVNRALSSLG
SGWMIHVDAIRQQTGAYPPPESSHFPHPALQLIDDSRRIFFEGQGDKYTSTTVIAVTYMPPVKTLSKITD
LIFEHQDKKESIATKNLARFNEKLNDIEGRLSASLRLTRLEAHQEDGRWVDPFLSYLRYCLTGHWHLITV
PIVPMAIDSLIGAVDMWTGFEPKVDDAYVSLISIDGFPLLSSPNVLNALDYMNVEYRWSTRFVFFDNREA
IQLLKTERKKWEQKVVSFKDKLIKNPNPPIDADALNMVNQYESANTALSAGELQYGHYTSTFVLRHKDRH
ALAEMTEYTTKTLNLIAGFSCRVETVNATEALLGTLPSDSLHNIRRPLLSTDNLCDLLPLASIWTGSETC
PCPFYPDNSPPLMVCTAQGNTPFRLNLHVEDVGHTLLFGPTGKGKSTALAIMVAQCFRYPNAQVFVFDKK
RSMYALSQLGGTHIDIGDNSAPSFAPLCDLDNDFEWCCDYIEQLLVLQSVSVTPAMRSAIFAALTTMRGS
PIQTLSEFKAQCQHNEIKTAIEYYTVQGRSGDLLDAQEDTLSLASFMVFEIDGLMKRGDKDAIPVLSYLF
RRIERSLNGQPSFIVLDEAWVAFSHPIFLAMLKEWLKELRKANCAVILATQSLSDAIKSGILDVLVESCP
TQIFLPNEKAPLFAETYHQFGLNDKQIELLRHATPKRDYYVCQPTGNRLIDLSLDPIALAFVAAGSKDDI
QRVKALVHEHQESWYIAWLTEQGLSFAP
 
Nucleotide Sequence: 2397 bp     [Download]
>gi|54301680|ref|NC_006371.1|:1748726-1751122 Photobacterium profundum SS9 chromosome 2, complete sequence
ATGTTTAATTTGAAAAGCTATCGTGACACCCAACAAGGCACACCGGATTTGCTCAATTGGGCGGCCATGG
TCGATAACGGGGTCATGCTCAATAAAGACGGCTCCTTTACCGCCGCTTGGACGTACACCGGATTGGATGC
GGCCACGGCCACCAATACCGATCGCAATGATGCGGTCTACCGTGTCAACCGCGCTCTGTCATCATTGGGA
TCGGGTTGGATGATCCATGTGGATGCCATTCGCCAGCAAACAGGGGCATACCCGCCCCCTGAATCGTCGC
ATTTCCCCCACCCCGCCTTGCAGTTAATCGATGATTCACGGCGAATTTTCTTTGAAGGGCAAGGGGATAA
ATACACCTCAACAACGGTCATTGCCGTGACGTACATGCCACCGGTCAAAACCCTGTCAAAAATCACCGAT
TTGATTTTTGAGCATCAAGATAAAAAGGAAAGTATTGCCACCAAAAACTTGGCCCGTTTTAACGAAAAAT
TAAATGATATCGAAGGGCGGTTATCCGCTTCCCTGCGATTAACCCGCCTTGAAGCCCATCAAGAGGATGG
CCGCTGGGTTGATCCTTTCCTGTCTTATCTGCGCTATTGCCTGACAGGGCATTGGCATCTCATCACCGTG
CCTATCGTCCCCATGGCCATTGACAGCTTGATTGGGGCGGTCGATATGTGGACGGGGTTTGAACCGAAAG
TGGATGATGCGTATGTCTCGCTCATTAGTATTGATGGGTTTCCGCTATTAAGCAGTCCGAATGTGCTCAA
TGCGCTGGACTACATGAATGTGGAGTATCGCTGGTCTACCCGCTTTGTGTTCTTCGATAACCGAGAAGCC
ATTCAACTGCTCAAGACCGAGCGTAAAAAATGGGAACAAAAAGTGGTGTCGTTTAAAGACAAGCTGATTA
AGAACCCAAATCCACCGATTGATGCCGATGCGCTGAACATGGTCAATCAGTATGAATCGGCCAACACCGC
CTTATCCGCAGGGGAGTTACAATACGGCCATTACACCAGCACCTTTGTCTTGCGCCATAAAGACCGGCAT
GCCCTCGCGGAAATGACCGAGTACACCACCAAGACCCTCAATCTTATCGCAGGGTTTTCGTGCCGAGTCG
AAACGGTCAATGCCACCGAAGCCTTGCTCGGCACACTGCCGTCAGATTCCTTGCACAATATCCGCCGCCC
TTTATTGAGCACCGACAATCTGTGCGATCTTCTGCCGTTGGCCAGTATTTGGACCGGCAGTGAAACCTGC
CCTTGTCCGTTTTACCCTGACAACTCCCCGCCACTCATGGTCTGTACCGCACAGGGTAATACCCCGTTTC
GATTGAACCTGCATGTGGAGGATGTGGGGCATACCTTGCTGTTCGGCCCCACGGGTAAAGGAAAATCCAC
CGCACTGGCGATTATGGTGGCGCAGTGTTTCCGTTATCCCAATGCACAGGTCTTTGTCTTTGATAAAAAG
CGGTCGATGTATGCCTTGAGTCAGTTGGGGGGCACGCACATTGATATTGGCGACAATAGCGCCCCGTCAT
TTGCACCGCTGTGCGATCTTGATAATGACTTTGAGTGGTGTTGCGATTACATCGAACAGTTGTTGGTGTT
GCAAAGTGTCAGTGTGACACCGGCGATGCGCAGTGCCATTTTCGCGGCATTGACGACGATGCGAGGCAGT
CCCATTCAAACCTTGTCGGAATTCAAAGCACAGTGCCAACACAATGAGATTAAAACCGCCATTGAATATT
ACACGGTACAAGGGCGAAGCGGGGATTTGCTGGATGCACAAGAAGACACCTTATCGCTGGCATCATTCAT
GGTATTTGAAATTGATGGCCTCATGAAACGGGGCGACAAAGACGCCATCCCCGTGCTGTCTTACCTCTTT
CGCCGTATCGAGCGGTCGTTAAACGGTCAACCCAGTTTCATTGTCTTGGATGAAGCGTGGGTCGCCTTTA
GTCACCCGATATTTCTGGCCATGTTAAAGGAGTGGTTGAAGGAATTACGCAAAGCCAATTGTGCGGTGAT
ACTGGCGACGCAATCACTGAGTGATGCGATTAAATCCGGCATCTTGGATGTGTTGGTTGAGTCATGTCCG
ACCCAAATATTCTTACCCAATGAAAAGGCGCCGCTGTTTGCCGAGACCTATCACCAGTTCGGGCTCAATG
ACAAACAAATCGAGTTACTTCGCCATGCGACCCCCAAACGTGATTACTACGTGTGTCAACCCACGGGCAA
CCGCTTGATTGACCTGTCACTGGATCCCATTGCGCTGGCGTTTGTAGCAGCGGGTAGCAAAGACGATATT
CAGAGAGTGAAAGCATTGGTTCATGAACATCAGGAGAGTTGGTATATCGCATGGTTAACCGAGCAAGGAC
TATCATTCGCGCCCTAA
 Primer design