SecReT4
Protein ID: 54303269
T4SS name [ID]Trb [241]
Gene symbol-
Locus tagPBPRB1602
StrainPhotobacterium profundum SS9
Repliconchromosome 2 [GenBank: NC_006371] [Browse all T4SS(s) in this replicon]
Location [Strand]1752026..1752934 [+]
Producthypothetical protein
Component typeTrbB
UniProt IDQ6LGW8
KEGG IDppr:PBPRB1602
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.5e-76, Aligned region: 9..275
ResIII [PF04851], Evalue: 3.2e-05, Aligned region: 124..182
Protein Sequence: 302 a.a.     [Download]
>gi|54303269|ref|YP_133262.1| hypothetical protein PBPRB1602 [Photobacterium profundum SS9]
MHHHMQQANITRYLDDDNITEIMLNPDGQLWIEAFGQPMRFCHIVSPEDALRIIHAIADCHHLIVDRQHP
LLECELPLDGSRFEGLADPVVAQTSFVIRKKATRVFTLDEYVEAGTLSHAQYDAIVALILAHRNIVIVGG
TGSGKTTLANAVLAKIAECFPNERLIILEDTNEIQCQARNHVIMRTCDKAGISMQTLLRATLRYRPDRII
VGEVRGGEALDLLKAWNTGHPGGILTIHADSARLGLDRLEQCISEVAVTINHRMIASTVHALIFIEKTAE
GRKIQDIVKVQGYQDGNYLFHT
 
Nucleotide Sequence: 909 bp     [Download]
>gi|54301680|ref|NC_006371.1|:1752026-1752934 Photobacterium profundum SS9 chromosome 2, complete sequence
TTGCACCACCATATGCAGCAAGCAAATATCACTCGGTATCTTGATGATGACAATATCACTGAAATCATGC
TCAACCCCGACGGTCAGTTATGGATTGAAGCCTTTGGTCAACCGATGCGCTTTTGTCATATCGTCTCGCC
GGAAGATGCCCTGCGTATCATTCATGCAATTGCCGATTGTCACCACCTTATTGTTGACCGCCAACACCCG
TTATTAGAATGCGAACTGCCGCTGGATGGCAGCCGTTTTGAGGGATTGGCCGATCCTGTTGTGGCACAAA
CCAGTTTTGTGATCCGCAAGAAAGCCACGCGGGTGTTCACCTTGGACGAGTATGTTGAGGCTGGGACATT
ATCCCACGCCCAATATGATGCCATTGTCGCGCTCATTCTGGCTCACCGCAATATTGTCATTGTCGGGGGA
ACCGGCTCAGGCAAAACCACGCTAGCCAATGCGGTGTTAGCCAAAATCGCTGAATGCTTTCCTAATGAGC
GGTTAATCATTTTAGAGGATACCAATGAAATTCAGTGCCAAGCCCGCAATCACGTGATCATGCGTACCTG
CGATAAAGCCGGCATCTCGATGCAAACCTTGTTGCGAGCGACTCTGCGCTATCGACCCGACCGCATCATT
GTCGGGGAAGTGCGGGGCGGCGAAGCGCTGGATTTACTCAAAGCATGGAACACCGGCCATCCTGGTGGGA
TCCTAACGATTCACGCGGATTCTGCCCGTTTGGGATTAGATAGGCTTGAGCAGTGTATCAGTGAAGTGGC
CGTTACGATTAACCACCGCATGATTGCGTCCACCGTGCATGCGCTGATATTTATTGAAAAGACCGCTGAG
GGCCGAAAAATACAAGACATTGTCAAGGTACAAGGCTACCAAGACGGCAATTACCTCTTTCATACGTAG
 Primer design