SecReT4
Protein ID: 54303270
T4SS name [ID]Trb [241]
Gene symbol-
Locus tagPBPRB1603
StrainPhotobacterium profundum SS9
Repliconchromosome 2 [GenBank: NC_006371] [Browse all T4SS(s) in this replicon]
Location [Strand]1752944..1754257 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDQ6LGW7
KEGG IDppr:PBPRB1603
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 4.8e-31, Aligned region: 54..266
Protein Sequence: 437 a.a.     [Download]
>gi|54303270|ref|YP_133263.1| conjugal transfer protein TrbL [Photobacterium profundum SS9]
MRVVILIIGLLFSRLSYAQNNNALDDLLGQFHTQTALWEPIILQSMWGLFWGLAVISLVWNAIQLVLHDK
GIVDFIAFLFNRVMTIGLSVWLITNASALAWAIINTFQKVAGLLSTNQEGFSPSNVFELGLSIAHKVYSS
ASGFSIGDNIVLGICALIILVVFAMIAAEMCILIVGAYVLVSSGVIVMAFLGSEWTRDHAMNYFTTVLGM
AVQLFVMQLIIIIGYSMFSGFMTQAGTGSADYLVMVGMCIVYFALVRVVPNMATSLATGRFVFGSGSAVA
AATSVAGAAAGAALLGAGAFGAMKGGIGNLAGKVGGGKIMDGVKSALSRFSPTSGTGKMAMKGATGAGKA
LSGSGKIAASMGKVGLNLLAQQSPVGRAMRDAASMASTPASQHQDVLNNLNAQQNAPSTSSSSPNTSTLS
TDEAAYQAMQSSMNHKE
 
Nucleotide Sequence: 1314 bp     [Download]
>gi|54301680|ref|NC_006371.1|:1752944-1754257 Photobacterium profundum SS9 chromosome 2, complete sequence
ATGCGGGTTGTCATACTCATCATTGGCCTACTTTTTAGTAGGCTTTCTTATGCACAAAACAATAATGCCT
TAGACGATTTACTCGGGCAATTCCACACGCAAACGGCGCTGTGGGAGCCCATTATCTTGCAATCCATGTG
GGGGCTGTTTTGGGGGTTGGCGGTGATTAGCCTGGTCTGGAATGCCATTCAATTAGTGCTCCACGATAAA
GGGATCGTCGATTTCATCGCCTTTCTCTTTAACCGTGTCATGACCATTGGCTTGTCCGTGTGGCTCATTA
CCAATGCCTCGGCCTTGGCATGGGCCATCATCAACACGTTTCAAAAAGTCGCCGGTCTGCTGAGTACCAA
CCAAGAGGGATTCAGTCCGTCCAATGTGTTTGAACTGGGTTTGAGCATTGCGCACAAAGTGTATAGCTCT
GCCAGTGGTTTCAGCATTGGCGATAACATTGTTTTGGGGATTTGCGCCCTCATTATTTTGGTTGTCTTCG
CCATGATTGCTGCTGAGATGTGCATCTTGATTGTTGGCGCGTATGTGTTGGTCAGTAGCGGGGTCATTGT
GATGGCCTTTCTCGGCAGTGAATGGACCCGAGACCATGCCATGAACTACTTCACCACCGTCTTAGGGATG
GCGGTGCAATTGTTCGTGATGCAACTCATCATCATTATTGGCTACAGCATGTTCAGTGGTTTCATGACGC
AAGCCGGTACTGGCAGTGCGGATTATCTGGTGATGGTCGGCATGTGTATTGTCTATTTTGCGTTGGTGCG
GGTCGTGCCGAACATGGCAACGTCACTCGCCACGGGCCGCTTTGTCTTCGGCAGTGGTTCAGCCGTGGCG
GCGGCAACCAGTGTCGCGGGTGCAGCAGCAGGCGCAGCGTTACTGGGTGCTGGCGCATTCGGTGCCATGA
AAGGCGGCATTGGCAATCTCGCAGGGAAAGTTGGGGGCGGCAAGATCATGGACGGTGTCAAAAGCGCCCT
GTCGCGTTTTTCACCCACCTCTGGCACGGGGAAAATGGCCATGAAAGGCGCCACGGGGGCAGGCAAGGCC
CTGTCTGGCTCCGGGAAGATAGCCGCCAGCATGGGAAAAGTCGGCCTGAACCTCCTCGCACAACAATCAC
CCGTGGGGCGCGCCATGCGTGATGCGGCCAGCATGGCCAGTACGCCCGCCAGTCAGCACCAAGACGTGCT
CAACAACCTGAACGCACAACAAAACGCACCGTCAACCTCGTCCTCATCACCCAACACTTCAACGCTCAGT
ACTGATGAAGCAGCCTATCAGGCCATGCAATCGAGTATGAATCACAAGGAATAA
 Primer design