SecReT4
Protein ID: 54303271
T4SS name [ID]Trb [241]
Gene symbol-
Locus tagPBPRB1604
StrainPhotobacterium profundum SS9
Repliconchromosome 2 [GenBank: NC_006371] [Browse all T4SS(s) in this replicon]
Location [Strand]1754260..1754928 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDQ6LGW6
KEGG IDppr:PBPRB1604
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 8.8e-43, Aligned region: 16..217
Protein Sequence: 222 a.a.     [Download]
>gi|54303271|ref|YP_133264.1| conjugal transfer protein TrbF [Photobacterium profundum SS9]
MNKQQADELSLLYQRGRHEWDERMGSVTHQAHVWKLAFFAALAITALSVGGVIYIGSQSKIEPYAVAINN
GEVMAAGKMSRLPQGQLNALQVKALTGFIENMRNVMVDVSAQKSAIIKAYAMMQNDSPAYLQANAHFKQQ
SPFARAETELVKVEVITVLPLSPDTYQAEWKETVTARSGKATYFKRYKATLNTVTQFPTTQTALNTNPLG
FFIRTFNDVEVH
 
Nucleotide Sequence: 669 bp     [Download]
>gi|54301680|ref|NC_006371.1|:1754260-1754928 Photobacterium profundum SS9 chromosome 2, complete sequence
ATGAATAAACAACAAGCCGATGAACTGTCCTTGCTCTATCAGCGGGGGCGGCATGAATGGGACGAACGCA
TGGGCTCAGTTACCCATCAGGCCCATGTCTGGAAGCTCGCGTTTTTTGCCGCACTGGCCATCACCGCTTT
GTCGGTCGGTGGGGTAATTTATATCGGCAGCCAATCAAAAATTGAACCGTATGCCGTGGCGATAAACAAT
GGCGAGGTCATGGCGGCGGGAAAAATGTCACGCTTGCCACAAGGACAATTGAATGCCTTGCAGGTCAAAG
CCCTCACTGGATTCATTGAAAACATGCGCAATGTCATGGTGGATGTCTCGGCACAAAAAAGTGCCATCAT
CAAGGCGTATGCCATGATGCAAAATGATTCCCCCGCCTATTTGCAAGCCAATGCGCATTTTAAACAACAA
AGCCCCTTTGCCCGCGCCGAAACGGAGTTGGTCAAAGTGGAAGTGATCACGGTGTTACCGTTATCCCCCG
ACACCTATCAGGCCGAATGGAAGGAAACAGTGACGGCACGAAGTGGTAAAGCCACCTATTTCAAGCGTTA
TAAAGCCACCTTGAACACCGTCACACAATTTCCCACCACCCAAACCGCCCTCAATACTAATCCGTTGGGC
TTTTTCATCCGCACCTTCAACGACGTTGAAGTGCACTAA
 Primer design