SecReT4
Protein ID: 54303272
T4SS name [ID]Trb [241]
Gene symbol-
Locus tagPBPRB1605
StrainPhotobacterium profundum SS9
Repliconchromosome 2 [GenBank: NC_006371] [Browse all T4SS(s) in this replicon]
Location [Strand]1754941..1755813 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDQ6LGW5
KEGG IDppr:PBPRB1605
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.2e-52, Aligned region: 70..288
Protein Sequence: 290 a.a.     [Download]
>gi|54303272|ref|YP_133265.1| P-type conjugative transfer protein TrbG [Photobacterium profundum SS9]
MKRWLPALWGVAFFSQAATVPALTSTPPNALSLFGQEQGLTANEREGVQLAQKWINGKTQPITAPDGAVV
YYYGASLPSVVCSPLKTCDIQLEAGEQLVKTGINTGDSVRWKITPTLSGSGDNAVTHIIVKPSDVGLETS
LMLTTNRRSYMFKLVSRQSDWMPVVRFDYPDTINTALSSLYAKRTSAQAEKQLGNGLNIDNLDFNYRVDG
QAAFTPVRVYNNSIKTILEMPRSVATGKLPSLLVVNAGRRELINYRYNRGKFIVDGLPKEIVLVIGAGKY
QQSVLIKHKG
 
Nucleotide Sequence: 873 bp     [Download]
>gi|54301680|ref|NC_006371.1|:1754941-1755813 Photobacterium profundum SS9 chromosome 2, complete sequence
ATGAAAAGATGGTTGCCCGCACTCTGGGGCGTGGCTTTTTTCTCTCAGGCGGCCACCGTGCCCGCCCTAA
CATCCACCCCACCCAATGCCTTGTCGCTGTTTGGACAAGAACAAGGGCTCACCGCCAACGAACGGGAAGG
GGTGCAGCTTGCTCAAAAATGGATAAACGGTAAAACCCAACCCATTACGGCCCCTGACGGGGCGGTGGTG
TATTACTACGGCGCGTCCCTGCCGTCGGTGGTGTGCTCCCCGCTGAAAACCTGTGATATCCAACTGGAAG
CGGGCGAGCAGTTGGTCAAAACCGGCATCAATACGGGGGATTCGGTGCGCTGGAAAATCACCCCGACCCT
GTCAGGCTCAGGGGACAATGCCGTCACACACATCATCGTCAAACCGTCCGATGTCGGGCTAGAAACCTCC
TTGATGCTCACCACCAACCGCCGTTCGTACATGTTTAAGCTCGTCAGTCGGCAATCGGATTGGATGCCCG
TCGTCCGATTTGATTACCCTGACACCATTAACACCGCCCTCTCATCCCTCTATGCCAAACGCACCTCGGC
TCAGGCAGAAAAACAATTGGGGAATGGGCTGAATATCGACAATTTGGATTTCAATTATCGCGTCGATGGC
CAAGCGGCGTTTACACCAGTGCGGGTCTACAACAACAGCATCAAAACCATTTTGGAAATGCCCCGCAGTG
TCGCCACGGGCAAACTGCCCTCACTGCTTGTGGTCAATGCGGGACGACGCGAATTAATCAATTACCGCTA
CAACAGAGGTAAGTTCATTGTCGATGGGCTGCCAAAAGAAATTGTATTGGTGATTGGGGCGGGAAAATAC
CAACAATCTGTTCTGATAAAGCACAAGGGATAA
 Primer design