SecReT4
Protein ID: 54303274
T4SS name [ID]Trb [241]
Gene symbol-
Locus tagPBPRB1607
StrainPhotobacterium profundum SS9
Repliconchromosome 2 [GenBank: NC_006371] [Browse all T4SS(s) in this replicon]
Location [Strand]1756319..1757455 [+]
Producthypothetical protein
Component typeTrbI
UniProt IDQ6LGW3
KEGG IDppr:PBPRB1607
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.6e-58, Aligned region: 191..373
Protein Sequence: 378 a.a.     [Download]
>gi|54303274|ref|YP_133267.1| hypothetical protein PBPRB1607 [Photobacterium profundum SS9]
MGVLLVFIIAIICVVLYVIASKGQHRVTDNAEVATNTVTDSRAGLAAALNTAPPDTTVIDDRVAQEAQAY
KDKHASTPPVKTALEVALEQEWLAIQKNRNQALLTALNATVSVTSPSLTAMQTPPAQDDAYRRAQENVAD
IQAQLYGAQDGNMSRQGSNNGSGQAEKWAFRQQDRRHDYLTEGRQAPLSPYELKVGTLIPASLVGAINSD
IPGQMTAQISQTVFDSATGSTVLLPQGAKLVGTYDSRVGYGQDRLPVVWTRINFPDASVLNLGGMDGVDV
SGQNGFTGDVDHHYWRIFGNALMLGMISGGTQAAVSDGNSEENSTGEDVANGVVQQFSQTGNQLIQKNLN
VQPTITIPNGYEFNIMLTKDVILPPYHS
 
Nucleotide Sequence: 1137 bp     [Download]
>gi|54301680|ref|NC_006371.1|:1756319-1757455 Photobacterium profundum SS9 chromosome 2, complete sequence
GTGGGGGTGTTATTGGTCTTTATCATTGCCATTATCTGTGTCGTGTTATACGTCATCGCCTCCAAAGGTC
AGCATCGCGTGACAGATAATGCCGAAGTTGCAACAAACACCGTGACCGATAGTCGAGCAGGATTGGCCGC
CGCCTTAAACACGGCCCCGCCAGATACAACCGTGATTGATGATCGTGTTGCTCAAGAGGCGCAAGCCTAT
AAGGACAAACATGCCTCGACACCGCCAGTAAAAACCGCCTTGGAGGTAGCACTTGAGCAAGAATGGTTGG
CCATTCAAAAAAACAGGAACCAAGCTTTACTGACGGCGTTAAATGCGACGGTATCCGTCACTTCCCCGTC
GTTAACGGCCATGCAGACCCCACCCGCTCAAGACGATGCTTATCGTCGGGCTCAAGAGAATGTGGCCGAT
ATTCAGGCGCAGCTTTACGGGGCGCAAGACGGAAACATGTCACGTCAAGGCAGTAATAATGGGTCAGGCC
AAGCTGAAAAATGGGCGTTTCGCCAGCAAGACCGCCGCCATGATTATTTAACCGAAGGACGCCAAGCCCC
GTTGAGTCCGTATGAATTGAAGGTCGGCACACTCATTCCTGCCAGTTTGGTGGGGGCGATTAACTCTGAC
ATTCCGGGACAAATGACGGCGCAAATCAGTCAGACGGTGTTTGACAGTGCGACAGGCAGTACCGTCTTAC
TGCCACAAGGTGCAAAACTGGTCGGCACGTATGACAGTCGCGTCGGGTACGGACAAGACCGATTGCCGGT
TGTCTGGACACGGATTAACTTTCCGGATGCGTCGGTGTTAAACCTTGGCGGCATGGACGGGGTGGATGTG
TCAGGGCAAAACGGGTTTACCGGCGATGTTGATCATCATTATTGGCGAATATTTGGCAATGCGCTGATGT
TAGGCATGATATCGGGCGGCACACAGGCGGCAGTCAGTGACGGCAACTCAGAAGAAAACAGCACAGGAGA
AGATGTGGCCAATGGCGTGGTGCAGCAGTTTTCACAAACGGGCAATCAACTGATCCAAAAAAACCTCAAT
GTTCAACCGACCATCACCATTCCCAATGGTTATGAATTCAACATCATGTTGACCAAAGACGTGATCTTAC
CGCCTTACCATTCGTAA
 Primer design