SecReT4
Protein ID: 54303287
T4SS name [ID]Trb [241]
Gene symbol-
Locus tagPBPRB1620
StrainPhotobacterium profundum SS9
Repliconchromosome 2 [GenBank: NC_006371] [Browse all T4SS(s) in this replicon]
Location [Strand]1767956..1768483 [+]
Productconjugal transfer protein TraF
Component typeTraF
UniProt IDQ6LGV0
KEGG IDppr:PBPRB1620
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 1.6e-32, Aligned region: 26..170
Protein Sequence: 175 a.a.     [Download]
>gi|54303287|ref|YP_133280.1| conjugal transfer protein TraF [Photobacterium profundum SS9]
MKAFKLSMIGLALFITLILSLFAIGLRWNESTSYPKGVYQLTSSTDYPRGTLILFCPPDNPALQMALERQ
YLRFGLCKGGFEPVIKRIVGIGGERVTFTDVISINQQQLPNTHRLQHDGFNRPLPQLDNFTLPDKTFFVI
SDHKPASSFDSRYYGAIPRGNVIGRIKPLFLLEGK
 
Nucleotide Sequence: 528 bp     [Download]
>gi|54301680|ref|NC_006371.1|:1767956-1768483 Photobacterium profundum SS9 chromosome 2, complete sequence
ATGAAAGCTTTCAAGTTATCAATGATAGGGCTCGCCCTTTTCATTACGCTTATTTTATCTCTTTTCGCTA
TCGGTCTACGCTGGAATGAAAGCACCTCCTACCCCAAAGGCGTGTACCAACTCACCAGCAGTACCGATTA
CCCACGAGGCACGTTAATCCTCTTCTGCCCGCCAGATAATCCAGCCCTTCAAATGGCACTAGAACGGCAA
TATTTGCGGTTTGGGTTGTGCAAAGGGGGATTTGAACCTGTCATCAAACGCATTGTGGGAATAGGCGGAG
AGCGCGTTACCTTCACCGATGTCATTAGTATTAACCAACAACAACTCCCCAACACGCACCGGCTTCAACA
CGATGGATTCAACCGCCCCCTCCCGCAACTAGACAATTTTACTCTGCCAGACAAGACCTTCTTTGTGATA
TCAGACCACAAACCCGCCAGTAGCTTTGATAGTCGATATTACGGTGCGATTCCGAGGGGAAATGTGATTG
GGAGAATTAAGCCGTTATTCTTACTCGAAGGTAAGTAG
 Primer design