SecReT4
Protein ID: 54303288
T4SS name [ID]Trb [241]
Gene symbol-
Locus tagPBPRB1621
StrainPhotobacterium profundum SS9
Repliconchromosome 2 [GenBank: NC_006371] [Browse all T4SS(s) in this replicon]
Location [Strand]1768486..1769013 [+]
Productconjugal transfer protein
Component typeTrbN
UniProt IDQ6LGU9
KEGG IDppr:PBPRB1621
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 175 a.a.     [Download]
>gi|54303288|ref|YP_133281.1| conjugal transfer protein [Photobacterium profundum SS9]
MFDIAPLEHCINQVHPAMVQKIIAVESASNPIAINVNILKGKPKPRYTPPKTKADAIRLANDYIRQGHSV
DLGLMQVNSNNLTHYGVTVNDMFNPCKNINVGSTILYEAYQRALRVKKTPQIALRHALSIYNTGNMTYGF
KNGYVNRYTPYESPKTAPASLYTNETTIPLGNLYD
 
Nucleotide Sequence: 528 bp     [Download]
>gi|54301680|ref|NC_006371.1|:1768486-1769013 Photobacterium profundum SS9 chromosome 2, complete sequence
ATGTTCGATATCGCCCCGTTAGAGCACTGCATCAATCAGGTGCACCCCGCCATGGTTCAAAAAATCATTG
CGGTAGAATCAGCCAGCAACCCTATCGCCATTAACGTCAATATCCTTAAAGGAAAACCCAAACCTCGATA
CACCCCGCCCAAGACAAAAGCAGACGCGATTCGGTTAGCCAATGACTATATCAGACAAGGGCATTCCGTA
GATTTAGGCTTGATGCAGGTCAACAGCAACAACCTCACGCATTACGGCGTCACGGTCAACGATATGTTTA
ACCCCTGCAAGAATATAAACGTCGGCTCGACGATTTTGTATGAAGCCTATCAACGCGCACTTCGTGTGAA
GAAAACGCCACAGATAGCATTGCGCCATGCACTTTCCATCTACAACACCGGCAACATGACCTACGGGTTT
AAAAATGGGTACGTGAACCGCTACACACCGTATGAAAGCCCCAAGACAGCCCCTGCCTCACTCTATACCA
ACGAGACGACTATCCCTCTCGGCAATCTTTATGATTAA
 Primer design