SecReT4
Protein ID: 54303289
T4SS name [ID]Trb [241]
Gene symbol-
Locus tagPBPRB1622
StrainPhotobacterium profundum SS9
Repliconchromosome 2 [GenBank: NC_006371] [Browse all T4SS(s) in this replicon]
Location [Strand]1769029..1770891 [+]
Producthypothetical protein
Component typeTraG
UniProt IDQ6LGU8
KEGG IDppr:PBPRB1622
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 6.2e-94, Aligned region: 110..606
TraG-D_C [PF12696], Evalue: 8.1e-28, Aligned region: 442..562
TrwB_AAD_bind [PF10412], Evalue: 6.9e-26, Aligned region: 339..563
Protein Sequence: 620 a.a.     [Download]
>gi|54303289|ref|YP_133282.1| hypothetical protein PBPRB1622 [Photobacterium profundum SS9]
MTTFAYQEQKQTQPVIKRLIAMAFFLCFALILNTLTTLYVENTLFHSVTFQQNPFNWMLWSIKFTQFKLY
FREVWLVHLALLIGGTLIFYLVTLTRKVATGNKTSQGTARWATREDIKQAGLLNGRGVYVGAFESKKNTL
EYLRHNTNEHVLCYAPTGSGKGVSFVLPTLLSWPASMVVLDNKPELYEETAGWRSQHANNICLKFDPARR
DSVKFNPLEEIRTNDYDASGRCTLGDFEVSDTQNIATVITNPNGKDELDHFNKNAYALIVALILHTLYVE
KQKGAVTSLSKVGDILKDPNTLDIYAMLSIMMTTPHMQLNSEQPIFAFGKADAESLQHCTKTDTHPIVLQ
TAAEMFKKPEKELGSIISTASEKFNLFLDPIVAENTSRSDFHYDDLRDNIQPVSLFIQVRDNDQERMRPL
VRLILTLILKRTTEHKNPHKHRLLLLLDEFTGIGKLKALETSLHFLRGYGVKVYIIIQDNVQLYQTYGRD
ETITSGCEVTIALAPNKSETAQLLSTMTGIGTVVQETLTTSGKKLSQGQNISRGIVEKSRPLLTVDECLR
LPPAVKDESGTRIISAGKMLIFVRGYHPILGTQSLYFKDPIFIARHAITPPIAQSQIDMI
 
Nucleotide Sequence: 1863 bp     [Download]
>gi|54301680|ref|NC_006371.1|:1769029-1770891 Photobacterium profundum SS9 chromosome 2, complete sequence
ATGACGACGTTTGCCTATCAAGAGCAGAAACAAACGCAACCTGTTATAAAACGCCTTATCGCCATGGCAT
TTTTTTTATGCTTTGCGTTAATACTCAACACCCTGACAACACTCTATGTTGAAAATACCCTTTTCCATTC
GGTCACTTTCCAGCAGAACCCGTTCAACTGGATGCTCTGGTCCATCAAATTTACGCAATTTAAGCTGTAT
TTTCGTGAGGTATGGTTAGTGCATCTCGCCCTATTGATTGGTGGCACACTCATATTCTACCTAGTCACGT
TGACCCGAAAGGTCGCCACGGGCAACAAGACCTCGCAGGGTACAGCGCGTTGGGCGACACGGGAGGACAT
CAAGCAAGCGGGCTTACTCAATGGTCGAGGGGTCTATGTAGGTGCGTTTGAATCCAAGAAAAATACCCTT
GAATATCTGCGTCACAATACCAATGAGCATGTGCTCTGTTACGCCCCGACAGGCTCGGGGAAAGGCGTCA
GTTTTGTTTTACCGACCCTATTAAGCTGGCCAGCCTCTATGGTGGTGCTCGATAACAAACCTGAACTGTA
TGAAGAAACGGCGGGATGGCGTAGCCAACATGCCAATAACATTTGCCTCAAATTCGACCCTGCCCGTCGA
GACTCCGTGAAGTTCAACCCGTTGGAAGAAATCAGAACCAATGACTACGATGCGTCAGGTCGTTGTACCT
TGGGGGATTTTGAAGTCTCAGACACCCAAAATATCGCGACTGTTATCACGAACCCAAACGGTAAAGATGA
ACTGGACCACTTCAATAAGAATGCCTATGCACTGATTGTGGCCCTGATATTACACACCTTGTACGTTGAA
AAACAAAAAGGCGCGGTTACCAGCTTGAGTAAGGTGGGCGACATACTAAAAGATCCGAACACATTAGATA
TTTACGCCATGTTATCTATTATGATGACCACGCCTCACATGCAACTCAATAGTGAACAACCTATCTTCGC
CTTTGGTAAAGCCGATGCCGAGAGCCTGCAACACTGCACCAAGACCGATACGCACCCTATCGTGCTGCAA
ACCGCTGCTGAAATGTTTAAAAAACCCGAAAAAGAACTCGGCAGTATCATCTCGACCGCCTCTGAAAAGT
TTAACCTGTTTCTCGACCCTATCGTCGCTGAAAACACCTCACGGTCAGATTTTCACTATGACGATTTACG
TGACAACATTCAGCCCGTTAGCTTATTTATTCAGGTTCGAGATAACGACCAAGAACGGATGCGCCCCCTA
GTCAGATTGATATTAACCCTCATCCTCAAACGCACGACGGAGCATAAGAACCCCCACAAGCACCGTTTAC
TGTTACTGCTCGATGAGTTCACGGGCATAGGCAAGTTAAAGGCATTGGAAACCTCCCTACACTTCCTGCG
AGGGTATGGGGTGAAGGTCTATATCATCATTCAAGATAACGTGCAGCTCTATCAAACTTACGGGCGGGAC
GAGACCATTACATCAGGGTGCGAGGTAACGATTGCCCTTGCGCCTAACAAGTCTGAAACCGCTCAACTGT
TATCAACCATGACGGGAATAGGAACGGTTGTGCAAGAAACCCTGACCACATCAGGTAAAAAGCTGTCACA
AGGTCAAAACATCAGTCGAGGCATCGTAGAGAAAAGTAGACCATTATTGACCGTGGATGAATGTTTGCGC
TTACCGCCAGCAGTAAAAGATGAAAGCGGAACCCGCATCATCAGCGCAGGCAAGATGCTTATTTTTGTGC
GGGGCTACCACCCTATTTTAGGGACGCAAAGTTTGTATTTTAAAGATCCCATCTTCATTGCCAGGCACGC
TATCACGCCACCGATAGCGCAATCACAAATAGATATGATCTAA
 Primer design