SecReT4
Protein ID: 55418009
T4SS name [ID]Trb [66]
Gene symboltrbB
Locus tagpB3_p04
StrainPlasmid pB3
Repliconplasmid pB3 [GenBank: NC_006388] [Browse all T4SS(s) in this replicon]
Location [Strand]3885..4850 [+]
ProductTrbB secretion system protein
Component typeTrbB
UniProt IDQ5W3K2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.4e-82, Aligned region: 28..294
FtsK_SpoIIIE [PF01580], Evalue: 3.3e-06, Aligned region: 143..181
AAA_29 [PF13555], Evalue: 5.3e-05, Aligned region: 146..176
AAA_16 [PF13191], Evalue: 9.3e-05, Aligned region: 136..179
Protein Sequence: 321 a.a.     [Download]
>gi|55418009|ref|YP_133909.1| TrbB secretion system protein [uncultured bacterium]
MSDQDNEHDSIKTRARKKLERDMGPTLLEALHDPKTQEILLNADGRLWLESQGKRLRCIGSLRRAQAQAI
IETVAGYHGKEVKRDSPLLEGEFPIDGSRFAGQLGPVVTGPTFAIRKKAIAVFTLAQYVERGIMTEAQKQ
AIERAAAAHKNILVIGGTSSGKTTLVNAIIQAMVDNDPLERFIIIEDTGEIQCTAENYVQYHTSIEVSMT
MLLKTTLRMRPDRILVGEVRGEEALDLLDAWNTGHPGGAATLHADSAQEGLVRLKSLVSRNKSAPSEIEP
LIGAAVHVVVHIAKTPDGSRRVQEILEVSGYVNGQYITKSL
 
Nucleotide Sequence: 966 bp     [Download]
>gi|55418005|ref|NC_006388.1|:3885-4850 Uncultured bacterium plasmid pB3 complete genome
ATGAGCGATCAAGACAACGAACACGACAGCATCAAAACGCGAGCGCGCAAGAAGCTCGAAAGGGACATGG
GGCCGACTCTGCTTGAGGCTCTGCACGATCCCAAGACTCAAGAAATTCTGCTCAACGCGGACGGCAGGCT
CTGGCTTGAAAGCCAGGGCAAGCGGCTGCGCTGTATCGGCAGCCTTCGCCGCGCGCAGGCACAAGCCATC
ATCGAAACGGTGGCGGGCTACCACGGCAAGGAAGTCAAACGGGACAGCCCCCTACTCGAAGGGGAGTTCC
CCATTGATGGCTCTCGGTTCGCGGGCCAGCTCGGCCCGGTCGTCACTGGCCCCACCTTTGCGATTCGCAA
GAAGGCCATCGCCGTTTTCACGCTGGCTCAATACGTCGAGCGCGGAATCATGACCGAGGCCCAAAAGCAG
GCCATCGAGCGCGCTGCTGCGGCCCACAAAAACATCCTCGTCATTGGTGGCACCAGTTCCGGCAAGACCA
CCCTCGTGAACGCCATCATCCAGGCGATGGTTGATAACGATCCTCTGGAGCGTTTCATCATCATCGAGGA
CACCGGCGAGATTCAATGCACCGCCGAGAACTACGTCCAGTACCACACCAGCATCGAAGTCAGCATGACG
ATGCTGCTGAAAACCACCCTCCGCATGCGCCCCGACCGAATCCTGGTCGGCGAAGTCCGTGGCGAAGAAG
CACTTGACCTGCTTGACGCCTGGAACACCGGACACCCCGGCGGCGCAGCCACCCTCCACGCCGACAGCGC
GCAAGAGGGCCTAGTTCGTTTGAAGTCGCTTGTTTCCCGGAATAAGTCGGCTCCATCCGAAATTGAACCG
CTGATAGGCGCGGCGGTTCATGTCGTTGTTCACATCGCCAAAACCCCGGACGGCTCGCGTCGTGTTCAGG
AAATCCTTGAGGTTTCCGGCTACGTGAACGGCCAGTACATCACCAAGTCCCTTTAA
 Primer design