SecReT4
Protein ID: 55418010
T4SS name [ID]Trb [66]
Gene symboltrbC
Locus tagpB3_p05
StrainPlasmid pB3
Repliconplasmid pB3 [GenBank: NC_006388] [Browse all T4SS(s) in this replicon]
Location [Strand]4864..5328 [+]
ProductTrbC conjugal transfer protein precursor
Component typeTrbC
UniProt IDQ5W3K1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.3e-19, Aligned region: 12..110
Protein Sequence: 154 a.a.     [Download]
>gi|55418010|ref|YP_133910.1| TrbC conjugal transfer protein precursor [uncultured bacterium]
MQASLSAFRFNRSAMFYLGLFALLAFMMLAPHPAFASEGTGGSLPYESWLTNLRNSVTGPVAFALSIIGI
VVAGGILIFGGELNGFFRTLIFIVLVMALLVGAQNMMSTFFGRGAEIAALTDGALHQVKVAALDVAGFPG
EAVMRWAERGHIAG
 
Nucleotide Sequence: 465 bp     [Download]
>gi|55418005|ref|NC_006388.1|:4864-5328 Uncultured bacterium plasmid pB3 complete genome
ATGCAAGCCTCTCTGTCGGCGTTCCGCTTCAACCGCAGCGCCATGTTCTACCTGGGCCTGTTCGCCCTCC
TGGCGTTCATGATGCTGGCCCCGCACCCTGCTTTCGCTTCCGAAGGCACCGGCGGTTCGCTGCCTTATGA
AAGCTGGCTGACCAACCTCCGCAACTCCGTCACCGGCCCGGTGGCCTTCGCGCTGTCGATCATCGGCATC
GTGGTCGCCGGCGGCATCCTGATCTTCGGCGGCGAACTCAACGGCTTCTTCCGCACGTTGATCTTCATCG
TCCTGGTCATGGCTCTGCTGGTCGGCGCGCAGAACATGATGAGCACGTTCTTCGGCCGTGGCGCGGAAAT
CGCCGCCCTGACCGATGGCGCTCTGCACCAGGTCAAGGTCGCCGCGCTGGACGTGGCCGGCTTCCCCGGC
GAAGCCGTCATGCGCTGGGCCGAGCGCGGCCACATCGCGGGGTAA
 Primer design