SecReT4
Protein ID: 55418011
T4SS name [ID]Trb [66]
Gene symboltrbD
Locus tagpB3_p06
StrainPlasmid pB3
Repliconplasmid pB3 [GenBank: NC_006388] [Browse all T4SS(s) in this replicon]
Location [Strand]5332..5643 [+]
ProductTrbD conjugal transfer protein
Component typeTrbD
UniProt IDQ5W3K0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 2.6e-26, Aligned region: 1..87
Protein Sequence: 103 a.a.     [Download]
>gi|55418011|ref|YP_133911.1| TrbD conjugal transfer protein [uncultured bacterium]
MALRAIPIRRAGNRENLFMGGDRELVMFSGLLAGALIFSAQEVRATVFGIALWFGALFALRLMAKADPKL
RHVYLRHRRYKPYYPARSTPFRDNTPSQGKQYK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|55418005|ref|NC_006388.1|:5332-5643 Uncultured bacterium plasmid pB3 complete genome
ATGGCTCTGCGCGCGATCCCCATCCGTAGGGCCGGCAACCGAGAAAACCTGTTCATGGGCGGGGATCGTG
AGCTGGTGATGTTCTCGGGCCTGCTGGCCGGCGCGCTGATTTTCAGCGCCCAAGAAGTGAGGGCAACGGT
GTTCGGCATCGCCTTGTGGTTCGGCGCGCTCTTCGCGCTGCGCCTCATGGCGAAGGCCGATCCGAAGCTG
CGACACGTGTACCTGCGGCACCGCCGGTACAAGCCGTACTACCCGGCTCGCAGCACGCCCTTCCGTGACA
ACACGCCGAGTCAAGGGAAGCAATACAAATGA
 Primer design