SecReT4
Protein ID: 55418012
T4SS name [ID]Trb [66]
Gene symboltrbE
Locus tagpB3_p07
StrainPlasmid pB3
Repliconplasmid pB3 [GenBank: NC_006388] [Browse all T4SS(s) in this replicon]
Location [Strand]5640..8198 [+]
ProductTrbE conjugal transfer protein precursor
Component typeTrbE
UniProt IDQ5W3J9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 1.7e-56, Aligned region: 218..431
AAA_10 [PF12846], Evalue: 2.9e-29, Aligned region: 489..770
Protein Sequence: 852 a.a.     [Download]
>gi|55418012|ref|YP_133912.1| TrbE conjugal transfer protein precursor [uncultured bacterium]
MIEAIAIAIAVLGAVLLLILFARIRAVDAELKLKKHRAKDAGLADLLNYAAVVDDGVIVGKNGSFMAAWL
YKGDDNASSTEEQREMVSFRINQALAGLGNGWMVHVDAVRRPAPNYSERGVSSFPDSVSFAIDEERRRLF
EGLGAMFEGYFVLTVTWFPPVLAQRKFVELMFDDDAVAPDHTARTTGLIAQFKREITSLESRLSSAVKMT
RLRGQKVVSEEGREVTHDDFLSWLQFCVTGLHHPVMLPSNPMYLDAVIGGQELWGGVVPKIGRKFIQVVA
IEGFPLESTPGVLSALAELPSEYRWSSRFIFMDQHESLKHLDKFRKKWKQKIRGFFDQVFNTNTGSINQD
AAAMVGDAEAAIAEVNSGLVAAGYYTSVVVLMDEDRERLAASALLVEKAVNRLAFAARIETINTLDAYLG
SLPGHGVENVRRPLINTMNLADLLPTSSIWTGSATAPCPMYPPLSPALMHCVTVGATPFRLNLHVRDLGH
TFMFGPTGAGKSTHLGIIAAQLRRYAGMSIYAFDKGMSMYPLAAGIRAATKGKSGLHFTVAADDDRLAFC
PLQFLETKGDRAWAMEWIDTILALNGVNTTPAQRNEIGNAIMSMHASGARTLSEFSVTIQDAAIREAIRQ
YTVDGSMGHLLDAEEDGLSLSDFTVFEIEELMNLGEKFALPVLLYLFRRIERALKGQPSVIILDEAWLML
GHPAFRAKIREWLKVLRKANCLVLMATQSLSDAANSGILDVIVESTATKIFLPNVYARDEDTSALYRRMG
LNARQIEILATAIPKRQYYYVSENGRRLYDLALGPMALAFVGASDKESVATIKSLEAKFGHEWVHEWLAG
RGLNLNDYLEAA
 
Nucleotide Sequence: 2559 bp     [Download]
>gi|55418005|ref|NC_006388.1|:5640-8198 Uncultured bacterium plasmid pB3 complete genome
ATGATCGAAGCAATCGCAATTGCCATTGCTGTGCTCGGTGCGGTTCTGTTGCTCATCCTCTTTGCCCGCA
TCCGGGCTGTCGATGCCGAGCTGAAGCTCAAGAAGCATCGCGCCAAGGATGCCGGCCTGGCCGATCTGCT
CAATTACGCCGCCGTGGTCGATGACGGCGTGATCGTGGGTAAGAACGGCTCCTTTATGGCCGCCTGGCTG
TACAAGGGGGATGACAACGCCAGCAGCACCGAGGAACAGCGGGAAATGGTGTCGTTCCGCATCAACCAGG
CCCTGGCGGGCCTGGGGAACGGCTGGATGGTGCATGTCGATGCTGTGCGTCGGCCTGCGCCGAACTACTC
GGAGCGGGGCGTGTCATCGTTCCCCGACTCCGTTTCCTTCGCCATTGACGAGGAACGCCGGCGCTTGTTC
GAGGGCCTGGGCGCGATGTTCGAGGGCTACTTTGTCCTGACCGTCACGTGGTTCCCGCCAGTGCTGGCCC
AGCGCAAGTTTGTCGAACTCATGTTCGATGACGATGCGGTGGCTCCCGACCATACGGCGCGCACTACGGG
CCTGATTGCGCAGTTCAAGCGCGAGATCACCAGCCTGGAATCGCGCCTGTCCTCGGCGGTCAAGATGACG
CGCCTGCGCGGCCAAAAGGTCGTGTCGGAAGAGGGCAGGGAAGTCACGCACGATGACTTCCTGAGCTGGT
TGCAGTTCTGCGTGACGGGCCTCCATCACCCGGTCATGCTGCCCAGCAATCCGATGTACCTGGATGCGGT
CATCGGCGGGCAAGAGCTGTGGGGCGGCGTCGTGCCCAAGATCGGGCGCAAGTTCATCCAGGTGGTCGCC
ATCGAAGGCTTCCCCTTGGAGTCAACGCCTGGGGTGCTCTCGGCCCTGGCCGAGCTGCCCAGCGAATACC
GCTGGTCGAGCCGCTTCATCTTCATGGATCAGCACGAGTCCTTGAAGCACTTGGACAAGTTCCGCAAGAA
GTGGAAGCAGAAGATTCGCGGCTTCTTCGATCAGGTGTTCAACACGAATACCGGCTCGATCAACCAGGAC
GCGGCCGCGATGGTCGGCGACGCCGAGGCGGCCATCGCCGAGGTCAACAGCGGCTTGGTGGCGGCCGGCT
ACTACACCAGCGTGGTCGTGCTGATGGACGAGGATCGGGAGCGCCTGGCGGCCTCCGCGCTCCTGGTCGA
GAAGGCCGTCAACCGCCTGGCCTTCGCGGCCCGTATCGAGACGATCAACACGCTCGATGCGTACCTGGGC
AGCTTGCCCGGCCACGGCGTCGAGAACGTGCGCCGGCCGCTCATCAACACGATGAACCTGGCCGACCTGC
TGCCGACAAGCTCTATCTGGACGGGCAGCGCCACGGCTCCGTGCCCGATGTACCCGCCGCTGTCGCCGGC
GCTCATGCACTGCGTGACGGTGGGCGCTACGCCGTTCCGCCTGAACCTGCACGTGCGCGACCTGGGCCAC
ACCTTCATGTTCGGCCCGACCGGCGCGGGTAAATCGACGCACCTGGGCATCATCGCCGCGCAGCTCCGTC
GCTACGCCGGCATGTCGATCTACGCCTTCGACAAGGGCATGTCGATGTACCCGCTCGCGGCCGGCATTCG
TGCGGCCACGAAGGGCAAGAGCGGCCTGCACTTCACCGTTGCCGCCGACGATGACCGCCTGGCCTTCTGC
CCGCTCCAGTTCCTCGAAACGAAGGGGGATCGGGCATGGGCGATGGAGTGGATCGACACCATCCTGGCGT
TGAACGGTGTCAACACCACGCCGGCGCAGCGCAACGAGATCGGCAACGCGATCATGAGCATGCACGCCAG
CGGCGCGCGCACGCTCTCCGAGTTCTCGGTGACGATCCAGGACGCGGCGATCCGCGAGGCCATCAGGCAG
TACACGGTGGACGGCTCGATGGGCCACCTGCTCGACGCCGAAGAGGACGGCCTGTCGCTGTCCGACTTCA
CGGTGTTCGAGATCGAAGAGCTGATGAACCTGGGCGAGAAGTTCGCGCTGCCGGTGCTGCTCTACCTGTT
CCGCCGCATCGAGCGCGCACTGAAAGGCCAGCCCTCCGTCATCATCCTGGACGAAGCCTGGTTGATGCTG
GGCCACCCCGCGTTCCGCGCCAAGATCAGGGAATGGCTCAAGGTGCTGCGCAAGGCGAACTGCCTTGTGC
TGATGGCGACGCAAAGCCTCTCCGACGCGGCCAACTCGGGCATCTTGGACGTGATCGTGGAATCGACCGC
GACCAAGATTTTCCTGCCCAACGTCTACGCCAGGGATGAGGACACATCGGCGCTCTATCGCCGCATGGGC
CTCAACGCGCGTCAGATCGAAATCCTGGCGACTGCCATTCCGAAGCGTCAGTACTACTACGTGTCGGAGA
ACGGCCGCCGTCTCTATGACCTTGCCCTGGGGCCGATGGCCCTGGCCTTCGTCGGTGCGTCCGACAAGGA
ATCGGTCGCCACCATCAAGAGCCTCGAAGCCAAGTTCGGCCACGAATGGGTGCATGAGTGGCTGGCCGGC
CGTGGGCTGAATCTCAACGACTACCTGGAGGCCGCATGA
 Primer design