SecReT4
Protein ID: 55418013
T4SS name [ID]Trb [66]
Gene symboltrbF
Locus tagpB3_p08
StrainPlasmid pB3
Repliconplasmid pB3 [GenBank: NC_006388] [Browse all T4SS(s) in this replicon]
Location [Strand]8195..8977 [+]
ProductTrbF conjugal transfer protein
Component typeTrbF
UniProt IDQ5W3J8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.3e-58, Aligned region: 46..258
Protein Sequence: 260 a.a.     [Download]
>gi|55418013|ref|YP_133913.1| TrbF conjugal transfer protein [uncultured bacterium]
MSIADTLKGLIFKKPAHPAEPRDPRRSKEPLAGGRRAGEAENPYLAARRTWNDHVGGVVSQRQTWQVIGI
LSLLIALAGVGGVIHIGSQSKFIPYVVEVDKLGQTVAAGPVQAAGKADPRVIHAAVADWMSCARMVSPDV
ALQRKCVFKAYSMLAPNDPATPKMNEWLNGTPDSSPFKRAEKEMVSVEIKTVIPQTPDTWQVEWVETTRD
RQGTLKGQPVTWRALVTTYIAEVTPNTTDEQLRNNPLSIYVRDYSWSRIQ
 
Nucleotide Sequence: 783 bp     [Download]
>gi|55418005|ref|NC_006388.1|:8195-8977 Uncultured bacterium plasmid pB3 complete genome
ATGAGCATCGCCGACACCCTCAAGGGCTTGATCTTCAAGAAGCCCGCCCACCCCGCCGAGCCGCGCGATC
CGCGCCGCTCGAAGGAACCGCTCGCCGGCGGCCGCCGTGCGGGCGAGGCCGAGAACCCCTATCTGGCCGC
GCGCCGCACCTGGAACGATCACGTGGGCGGCGTCGTCTCGCAGCGCCAGACCTGGCAGGTGATCGGCATC
CTGTCGCTGTTGATCGCGCTGGCCGGCGTGGGCGGCGTGATCCACATCGGCAGCCAGTCGAAGTTCATCC
CCTACGTGGTCGAGGTGGACAAGCTGGGCCAGACCGTGGCCGCCGGCCCGGTGCAGGCCGCAGGGAAGGC
CGATCCGCGTGTCATCCACGCCGCCGTCGCGGACTGGATGAGCTGCGCGCGCATGGTGTCGCCTGACGTG
GCCTTGCAGCGCAAGTGCGTGTTTAAGGCGTACTCGATGCTCGCCCCCAACGATCCGGCGACGCCAAAGA
TGAACGAGTGGTTGAACGGAACGCCCGATTCCAGCCCGTTCAAGCGCGCCGAGAAAGAAATGGTCAGTGT
CGAGATCAAGACCGTCATCCCGCAGACGCCCGACACCTGGCAAGTCGAGTGGGTGGAAACCACGCGCGAC
CGCCAAGGCACGCTGAAAGGTCAGCCCGTCACCTGGCGCGCGCTCGTGACTACCTACATCGCCGAGGTCA
CGCCCAACACCACCGATGAGCAACTGCGGAACAACCCGTTGAGCATCTACGTGCGTGATTACTCCTGGTC
CCGCATCCAATGA
 Primer design