SecReT4
Protein ID: 55418014
T4SS name [ID]Trb [66]
Gene symboltrbG
Locus tagpB3_p09
StrainPlasmid pB3
Repliconplasmid pB3 [GenBank: NC_006388] [Browse all T4SS(s) in this replicon]
Location [Strand]8995..9894 [+]
ProductTrbG conjugal transfer protein precursor
Component typeTrbG
UniProt IDQ5W3J7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.4e-66, Aligned region: 73..298
Protein Sequence: 299 a.a.     [Download]
>gi|55418014|ref|YP_133914.1| TrbG conjugal transfer protein precursor [uncultured bacterium]
MKKTLSALIVGAAVAVPSLALAAPGDDIADKYFNKTNPTLTAQERAALAIAKRWEAGSATGIKPVAGAGG
AIKFVYGAQQPSIVCAVLQVCDVALQPGEQVNSINLGDTARWTVEPAITGSGATEVQHLIIKPMDVGLET
SLVVTTNRRSYHFRLRSHRTEYMPQVSFTYPEEAQAKWDAIQRREKQERTDNTLPATGEYLGDLSFDYEL
SGSASWKPVRVYNDGRKTIIEMPGTMQQTEAPTLLVVRKEGGLFTDDETVLVNYRVQGNRYIVDTVFDRA
ILIAGVGSSQDRVTISRRK
 
Nucleotide Sequence: 900 bp     [Download]
>gi|55418005|ref|NC_006388.1|:8995-9894 Uncultured bacterium plasmid pB3 complete genome
ATGAAGAAAACCCTCTCCGCTTTGATCGTGGGCGCTGCTGTGGCGGTGCCCTCCCTGGCTCTGGCCGCCC
CTGGCGACGACATTGCCGACAAGTATTTCAACAAGACCAACCCAACGCTGACCGCTCAAGAGCGCGCGGC
GCTCGCCATCGCCAAGCGGTGGGAAGCGGGGTCGGCGACCGGCATCAAGCCGGTGGCTGGTGCGGGCGGT
GCCATCAAGTTCGTGTACGGCGCGCAGCAACCGAGCATTGTTTGCGCGGTGCTTCAAGTGTGCGACGTGG
CCTTGCAGCCCGGCGAACAAGTGAACTCGATCAACCTGGGCGACACAGCCCGGTGGACGGTGGAACCGGC
CATCACCGGCAGCGGCGCGACCGAGGTTCAGCACCTCATCATCAAGCCGATGGACGTGGGCCTCGAAACC
AGCCTGGTCGTGACCACGAACCGCCGCAGCTACCACTTCCGCCTGCGCTCGCATCGCACCGAGTACATGC
CGCAAGTCTCGTTCACGTACCCCGAGGAAGCGCAAGCCAAGTGGGATGCGATCCAGCGCCGCGAGAAGCA
GGAACGCACCGACAACACCCTGCCGGCGACCGGCGAGTACCTGGGCGATCTCTCGTTCGACTATGAGCTG
TCCGGGTCGGCGAGCTGGAAGCCTGTGCGCGTCTACAACGATGGCCGCAAGACCATCATCGAAATGCCCG
GCACGATGCAGCAGACCGAAGCGCCGACGCTCCTGGTCGTGCGCAAAGAGGGCGGCCTGTTCACCGACGA
CGAAACGGTGCTGGTCAATTACCGCGTGCAGGGCAATCGCTACATCGTGGACACGGTGTTTGATCGCGCG
ATCCTGATTGCCGGTGTTGGCAGCAGCCAAGACCGCGTGACCATCAGCCGGAGGAAGTGA
 Primer design