SecReT4
Protein ID: 55418015
T4SS name [ID]Trb [66]
Gene symboltrbH
Locus tagpB3_p10
StrainPlasmid pB3
Repliconplasmid pB3 [GenBank: NC_006388] [Browse all T4SS(s) in this replicon]
Location [Strand]9891..10385 [+]
ProductTrbH conjugal transfer protein precursor
Component typeTrbH
UniProt IDQ5W3J6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbH [PF07283], Evalue: 4e-49, Aligned region: 35..164
Protein Sequence: 164 a.a.     [Download]
>gi|55418015|ref|YP_133915.1| TrbH conjugal transfer protein precursor [uncultured bacterium]
MTMRKIVSLALCALALGLGGCATTSQYGNFVQSAALDQQKLATDAVQQLATLYAPARTRLELQQPTPDPF
GQALVKSLRDKGYALLEYAPAGASAQAPASAASQPSAPATTAAPGGLPLRYVLDQAGDSNLYRLTLMVGN
QSITRPYLAQNGTFAPAGYWVRKE
 
Nucleotide Sequence: 495 bp     [Download]
>gi|55418005|ref|NC_006388.1|:9891-10385 Uncultured bacterium plasmid pB3 complete genome
GTGACCATGCGCAAGATCGTCTCTCTCGCGCTGTGCGCCCTCGCCCTGGGCCTCGGCGGCTGCGCCACCA
CCAGCCAGTACGGCAACTTCGTCCAGTCGGCCGCGCTCGATCAGCAGAAGCTCGCCACCGACGCGGTGCA
ACAGCTCGCCACGCTGTACGCGCCGGCGCGCACGCGCCTGGAGCTGCAACAGCCGACGCCCGATCCGTTC
GGCCAGGCTCTCGTCAAGTCGCTGCGCGACAAGGGCTATGCCCTCCTGGAGTACGCCCCGGCCGGCGCTT
CCGCGCAGGCCCCGGCCTCGGCGGCATCGCAGCCGAGCGCACCGGCCACCACGGCCGCGCCGGGCGGCCT
GCCGCTGCGCTACGTGCTCGACCAGGCTGGCGACTCGAACCTGTACCGCCTGACCTTGATGGTCGGCAAT
CAATCCATCACCCGCCCTTACCTGGCGCAAAACGGCACGTTCGCGCCGGCCGGGTACTGGGTGCGCAAGG
AGTGA
 Primer design