SecReT4
Protein ID: 55418016
T4SS name [ID]Trb [66]
Gene symboltrbI
Locus tagpB3_p11
StrainPlasmid pB3
Repliconplasmid pB3 [GenBank: NC_006388] [Browse all T4SS(s) in this replicon]
Location [Strand]10390..11811 [+]
ProductTrbI conjugal transfer protein
Component typeTrbI
UniProt IDQ5W3J5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 7.7e-66, Aligned region: 279..464
Protein Sequence: 473 a.a.     [Download]
>gi|55418016|ref|YP_133916.1| TrbI conjugal transfer protein [uncultured bacterium]
MTENADQMAPDASPGEVSKKAGVRRVNNMPMYILGGVLLSFVLVMALVAADRAAKQNAPADGPKEKAGNT
SMFAKEIAGDKTGGLIEPASPLKVPDMPTGPASAPLEIARPSNPDAPPAPPANPGNPGQPVNDDEAQRIR
MAKMQMFGEAVKAKTTVRVDAPRSNGSAPGGPSTYTATPQTRDEMLNRIAAVQQQIDAQRSNDPTAAYQA
RLAQIRGMGVGGGGAAPAGGGMGAGGAPQLLQTSTSGGGRNSMAQFGQGGQGDRWKLDSQPEAPRTPFEL
RAGFVVPATLISGINSDLPGQIMAQVAQDVYDTPTGKHLLIPQGSRLVGSYSSDVAYGQARVLVAWQRIV
FPDGKAMDIGAMPGADSAGYAGFNDQVNNHYVRLFGSAFLMSGVTAGITYSQRQNQATNTYGAPSASSAL
SEALGQQLGQVTAQLIAKNLSISPTLEIRPGYRFNVVVTKDMTFSKPYRSFDY
 
Nucleotide Sequence: 1422 bp     [Download]
>gi|55418005|ref|NC_006388.1|:10390-11811 Uncultured bacterium plasmid pB3 complete genome
ATGACAGAAAACGCCGATCAGATGGCACCTGACGCTTCGCCTGGCGAAGTGTCCAAGAAGGCGGGCGTCC
GTCGCGTCAACAACATGCCCATGTACATCCTCGGCGGCGTCCTGCTGTCGTTCGTGCTGGTCATGGCCCT
GGTCGCGGCGGATCGCGCGGCCAAGCAGAACGCGCCGGCGGACGGCCCGAAAGAGAAGGCCGGCAACACG
TCGATGTTCGCCAAGGAGATCGCCGGCGACAAGACCGGCGGCTTGATCGAGCCGGCAAGCCCGCTCAAGG
TGCCCGACATGCCGACCGGCCCGGCCTCGGCTCCGCTGGAGATCGCGCGGCCGTCCAACCCGGACGCGCC
GCCGGCACCGCCGGCCAACCCCGGCAACCCGGGCCAGCCGGTGAACGATGACGAGGCCCAGCGCATCCGC
ATGGCGAAGATGCAGATGTTCGGCGAGGCCGTGAAGGCCAAGACCACCGTGCGCGTGGATGCCCCGCGCA
GCAACGGCTCCGCGCCGGGTGGCCCGAGCACCTACACCGCCACGCCGCAGACGCGCGATGAAATGCTGAA
CCGCATCGCAGCGGTGCAGCAGCAAATCGACGCGCAGCGCAGCAACGATCCGACCGCCGCCTATCAAGCG
CGCCTGGCGCAGATTCGCGGCATGGGTGTCGGTGGTGGCGGTGCGGCCCCGGCCGGCGGCGGCATGGGCG
CGGGCGGTGCGCCGCAGCTCCTGCAAACCTCGACCAGCGGCGGCGGGCGCAACAGCATGGCGCAGTTCGG
CCAGGGCGGGCAGGGCGACCGCTGGAAGCTGGATTCGCAGCCGGAAGCGCCGCGCACGCCGTTCGAGCTG
CGCGCGGGCTTCGTCGTGCCGGCCACGCTCATTTCGGGCATCAACTCCGATCTGCCGGGCCAAATCATGG
CCCAGGTCGCGCAGGACGTGTACGACACGCCGACCGGCAAGCATCTGTTGATTCCGCAGGGATCGCGCCT
CGTCGGCTCGTATTCGAGCGACGTTGCCTACGGCCAGGCGCGCGTGCTGGTTGCGTGGCAGCGCATCGTG
TTCCCCGATGGCAAGGCAATGGACATTGGCGCGATGCCGGGCGCGGACAGCGCAGGCTACGCGGGCTTCA
ACGATCAGGTGAACAACCACTATGTGCGCCTGTTCGGTTCGGCCTTCCTCATGTCCGGCGTGACGGCTGG
CATCACCTACAGCCAGCGCCAGAACCAGGCCACGAACACCTACGGCGCACCGAGCGCCAGCAGTGCCCTA
AGCGAAGCCCTCGGCCAGCAGCTCGGCCAGGTCACGGCCCAGCTCATCGCCAAGAACCTGAGCATTTCGC
CGACGCTGGAAATTCGGCCGGGTTATCGCTTCAACGTCGTGGTCACGAAGGACATGACGTTTTCCAAGCC
GTACCGTTCCTTCGATTACTAA
 Primer design