SecReT4
Protein ID: 55418017
T4SS name [ID]Trb [66]
Gene symboltrbJ
Locus tagpB3_p12
StrainPlasmid pB3
Repliconplasmid pB3 [GenBank: NC_006388] [Browse all T4SS(s) in this replicon]
Location [Strand]11832..12596 [+]
ProductTrbJ conjugal transfer/entry exclusion protein precursor
Component typeTrbJ
UniProt IDQ5W3J4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 254 a.a.     [Download]
>gi|55418017|ref|YP_133917.1| TrbJ conjugal transfer/entry exclusion protein precursor [uncultured bacterium]
MKQKFLAAKLALVVAVSSTLAVTPVQAGIPVIDGTNLSQNIMTAIESVAQTLKQIEQYSTQLQQYQNQLQ
NTMAPAAYIWDQAQSTINGLMNAVNTLDYYKTQLGSLDSYIGKFQDVNYYKNSPCFTAAGCSDAERAALR
NVAQLASESQKKANDALFKGLDRQQTNLTADAATLQRLQSAAQGAQGQMQAIGYANQLASQQANQLLQIR
GLLIAQQNAMATKMQADADKEAQQAAAAAQLRQGSYRASPARTW
 
Nucleotide Sequence: 765 bp     [Download]
>gi|55418005|ref|NC_006388.1|:11832-12596 Uncultured bacterium plasmid pB3 complete genome
ATGAAGCAGAAGTTTTTAGCCGCTAAATTGGCCCTCGTCGTTGCTGTTTCGAGCACGCTGGCGGTCACAC
CTGTGCAGGCTGGCATCCCCGTCATCGACGGCACCAACCTGTCGCAGAACATCATGACGGCCATCGAATC
GGTGGCCCAGACGCTCAAGCAAATTGAGCAGTACAGCACCCAGCTCCAGCAGTATCAAAACCAGCTCCAG
AACACGATGGCCCCGGCCGCGTATATCTGGGATCAGGCGCAATCGACCATCAACGGGTTGATGAACGCGG
TCAACACGCTGGACTACTACAAGACCCAACTCGGCAGCCTGGATAGCTACATCGGCAAGTTCCAGGACGT
GAATTACTACAAGAACTCGCCGTGCTTTACGGCGGCAGGGTGCTCCGACGCGGAACGCGCAGCGCTTCGG
AATGTGGCCCAGCTCGCGAGCGAGTCGCAGAAGAAGGCCAACGATGCCTTGTTCAAGGGACTCGATAGGC
AGCAAACGAATCTCACGGCCGATGCAGCGACGTTGCAGCGTCTTCAATCGGCAGCGCAGGGCGCGCAAGG
CCAAATGCAGGCCATCGGCTACGCCAACCAGCTCGCTAGCCAGCAGGCCAACCAGCTCTTGCAGATTCGT
GGCCTGCTGATCGCGCAGCAGAACGCGATGGCAACCAAGATGCAGGCCGACGCCGACAAGGAAGCCCAGC
AGGCGGCAGCGGCCGCACAACTGCGCCAGGGCAGCTACCGGGCCAGCCCGGCGCGCACCTGGTAA
 Primer design