SecReT4
Protein ID: 55418018
T4SS name [ID]Trb [66]
Gene symboltrbK
Locus tagpB3_p13
StrainPlasmid pB3
Repliconplasmid pB3 [GenBank: NC_006388] [Browse all T4SS(s) in this replicon]
Location [Strand]12606..12833 [+]
ProductTrbK entry exclusion protein precursor
Component typeTrbK
UniProt IDQ5W3J3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 75 a.a.     [Download]
>gi|55418018|ref|YP_133918.1| TrbK entry exclusion protein precursor [uncultured bacterium]
MKAIKALSLTSAALVAALVAGCDNKPATAPMPEVNDENCKPENIAKIEDKGVQQAFSSLCLRRGGEFKPS
PKREW
 
Nucleotide Sequence: 228 bp     [Download]
>gi|55418005|ref|NC_006388.1|:12606-12833 Uncultured bacterium plasmid pB3 complete genome
ATGAAAGCAATCAAGGCTCTGTCCTTGACCTCGGCCGCCCTCGTGGCGGCCTTGGTCGCCGGCTGCGACA
ACAAGCCGGCCACGGCCCCCATGCCGGAAGTGAACGACGAGAACTGCAAGCCCGAGAACATCGCCAAGAT
CGAGGACAAGGGCGTCCAGCAGGCTTTCTCGTCGCTGTGCTTGCGTCGTGGTGGGGAGTTCAAGCCCAGC
CCGAAACGCGAATGGTGA
 Primer design