SecReT4
Protein ID: 55418019
T4SS name [ID]Trb [66]
Gene symboltrbL
Locus tagpB3_p14
StrainPlasmid pB3
Repliconplasmid pB3 [GenBank: NC_006388] [Browse all T4SS(s) in this replicon]
Location [Strand]12844..14574 [+]
ProductTrbL plasmid conjugal transfer protein precursor
Component typeTrbL
UniProt IDQ5W3J2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.7e-38, Aligned region: 65..279
Protein Sequence: 576 a.a.     [Download]
>gi|55418019|ref|YP_133919.1| TrbL plasmid conjugal transfer protein precursor [uncultured bacterium]
MRMPANLKTLALPLFVWLAFFAVDAHAAIDNAGVFDSVLDRYQAAASGWAGVITTAATWLFWTLVVISMV
WTFGMMALRKADIGEFFAEFVRFTIFTGFFWWALTNGPNFASSIYASLRQLAGNATGLGNALSPSGIVDV
GFAIFDKVMDQSSVWSPVDSMAGILMAVAILVILALVGVNMLLLLASGWVLAYGGVFFLGFGGSRWTSDM
AINYYKVVLGVAAQLFAMVLLVGIGKTFLDDYYSRMSAGISLKEMGVMLIVVIILLALVNKIPPLIAGII
TGASVGGAGIGQFGAGAALGAAGMAAAAAATGGAALAAGAASAAGGASAVMAAFSKANENVSAGTDVMSA
FSGGGSSGGGAGGGGDASTGSTPFAQAAGFSGSSGGGSSSGGGSPSTGSSSGSSKGGDKGGGKADAGGQG
SSSTASTGSSADKAAKNEPKPAGGAGQGQQGGQQAAPGSTGPGFLASAASALGTAGRIAADAGANLAKGT
ADVAKAKAASLRDAAAERIADTTGGKIAAAIKAQGSGTAENIDVPDQQPAPSFGDNSLAGGPADADPESE
VAAFANREQGRDGTTA
 
Nucleotide Sequence: 1731 bp     [Download]
>gi|55418005|ref|NC_006388.1|:12844-14574 Uncultured bacterium plasmid pB3 complete genome
ATGAGAATGCCAGCCAATCTAAAAACCCTCGCCCTGCCGCTGTTCGTCTGGCTGGCGTTCTTCGCGGTCG
ATGCTCATGCGGCCATCGACAACGCCGGCGTGTTCGATAGCGTGCTGGATCGCTACCAGGCCGCAGCGAG
CGGCTGGGCGGGTGTCATCACCACGGCCGCAACCTGGCTCTTCTGGACGCTGGTTGTGATCTCGATGGTC
TGGACGTTCGGCATGATGGCCTTGCGCAAGGCCGACATTGGCGAGTTCTTCGCGGAGTTCGTCCGCTTCA
CGATCTTTACCGGCTTCTTCTGGTGGGCACTGACCAACGGCCCTAACTTCGCCTCGTCCATCTATGCGTC
GCTGCGGCAGCTCGCCGGCAACGCGACGGGCCTGGGCAATGCGTTGTCGCCCTCGGGCATCGTGGACGTG
GGCTTTGCGATCTTCGACAAGGTGATGGATCAGTCCTCGGTGTGGTCGCCGGTGGACAGCATGGCCGGCA
TCCTCATGGCCGTTGCGATCCTGGTCATCCTGGCCCTGGTCGGCGTGAACATGCTTCTGCTGCTCGCGTC
GGGTTGGGTGCTCGCCTACGGTGGCGTGTTCTTCCTCGGTTTCGGTGGTTCGCGCTGGACTTCCGACATG
GCGATCAACTACTACAAGGTCGTCCTGGGCGTGGCCGCGCAGCTCTTCGCAATGGTGCTCCTGGTGGGCA
TCGGCAAGACCTTCCTCGATGACTACTACTCGCGCATGAGCGCCGGCATCAGCCTCAAGGAAATGGGCGT
GATGCTGATCGTCGTCATCATCCTCTTGGCGTTGGTCAACAAGATTCCGCCGCTCATTGCCGGGATCATC
ACCGGCGCGAGCGTGGGCGGTGCCGGCATCGGCCAGTTCGGTGCAGGCGCTGCGCTGGGTGCCGCAGGCA
TGGCGGCAGCAGCGGCCGCCACTGGCGGCGCCGCTCTGGCCGCCGGCGCAGCCTCGGCCGCCGGTGGTGC
CTCGGCCGTCATGGCCGCCTTCTCGAAGGCCAATGAGAACGTGTCGGCAGGCACGGACGTTATGTCGGCC
TTCTCGGGCGGCGGCAGCTCGGGCGGCGGTGCGGGCGGCGGTGGCGACGCCAGCACCGGCAGCACGCCCT
TCGCTCAAGCTGCGGGCTTTAGCGGCAGCTCCGGCGGTGGCTCTTCGTCGGGTGGCGGCAGCCCCTCGAC
CGGCAGCAGCTCGGGCAGCTCGAAGGGTGGCGACAAGGGCGGCGGCAAAGCCGACGCCGGCGGTCAGGGC
AGCAGCTCGACGGCAAGCACCGGCAGCAGTGCCGACAAGGCCGCCAAGAACGAACCCAAGCCAGCCGGCG
GGGCAGGGCAGGGGCAGCAGGGCGGCCAGCAGGCCGCACCGGGCAGCACCGGCCCCGGCTTCCTCGCGTC
GGCCGCCTCGGCGCTCGGCACGGCCGGCCGCATCGCCGCCGACGCCGGCGCGAACTTGGCGAAGGGAACC
GCCGATGTTGCCAAGGCCAAGGCCGCGAGCCTGCGCGACGCAGCAGCCGAACGGATTGCCGACACCACCG
GCGGAAAGATCGCCGCCGCGATTAAGGCGCAAGGAAGCGGCACGGCAGAGAACATCGACGTGCCCGACCA
GCAGCCCGCGCCGAGCTTCGGCGACAACAGCCTGGCAGGCGGCCCCGCCGATGCCGATCCCGAGTCCGAA
GTAGCCGCGTTCGCCAACCGCGAGCAAGGCCGCGACGGCACAACTGCGTAA
 Primer design