SecReT4
Protein ID: 55418021
T4SS name [ID]Trb [66]
Gene symboltrbN
Locus tagpB3_p16
StrainPlasmid pB3
Repliconplasmid pB3 [GenBank: NC_006388] [Browse all T4SS(s) in this replicon]
Location [Strand]15193..15828 [+]
ProductTrbN, putative muramidase
Component typeTrbN
UniProt IDQ5W3J0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 211 a.a.     [Download]
>gi|55418021|ref|YP_133921.1| TrbN, putative muramidase [uncultured bacterium]
MPFFADLPPQLQERVVCSISAAVKYEVPVNIVLAVAEKEGGKPGQWVRNSNGTHDVGPMQFNTAYLGDLA
RYGITANDVAAAGCYSFDLAAWRLRMHIRNDKGDLWTKAANYHSRTPQYNAVYRADLMRKASKWADWLEA
RFVTLDVTKAGATPSTPSQPATMAQRATPAARPAPAPQQAAPAAAAARSVSVAGYVPRTVSFNTSREGSA
E
 
Nucleotide Sequence: 636 bp     [Download]
>gi|55418005|ref|NC_006388.1|:15193-15828 Uncultured bacterium plasmid pB3 complete genome
ATGCCGTTCTTCGCCGATCTGCCGCCGCAGCTCCAGGAGCGTGTCGTCTGCTCGATCTCGGCCGCCGTCA
AGTACGAGGTGCCGGTCAACATCGTGTTGGCCGTCGCCGAGAAAGAGGGCGGCAAGCCGGGCCAGTGGGT
GCGCAACTCGAATGGCACGCATGACGTTGGCCCGATGCAGTTCAACACTGCGTACCTGGGCGACCTGGCC
CGGTACGGCATCACGGCGAACGATGTGGCGGCTGCCGGCTGCTACTCGTTCGACCTGGCCGCCTGGCGGC
TGCGGATGCACATCCGCAACGACAAGGGCGACCTCTGGACGAAGGCGGCGAACTACCACTCGCGCACGCC
GCAGTACAACGCGGTGTACCGGGCCGACCTGATGCGCAAGGCGTCGAAGTGGGCCGATTGGCTCGAAGCT
CGGTTCGTCACGCTCGACGTGACGAAGGCAGGGGCCACCCCCTCGACGCCCAGCCAGCCCGCGACGATGG
CCCAGCGGGCGACGCCGGCGGCCAGGCCGGCACCAGCACCCCAGCAGGCCGCCCCAGCGGCCGCAGCAGC
TCGCAGCGTGTCGGTGGCCGGCTACGTGCCCCGCACGGTGTCTTTCAACACTTCACGCGAGGGGTCGGCC
GAGTAG
 Primer design