SecReT4
Protein ID: 55418043
T4SS name [ID]Trb [66]
Gene symboltraF
Locus tagpB3_p40
StrainPlasmid pB3
Repliconplasmid pB3 [GenBank: NC_006388] [Browse all T4SS(s) in this replicon]
Location [Strand]40664..41200 [-]
ProductTraF maturation peptidase precursor
Component typeTraF
UniProt IDQ5W3G8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 1.7e-45, Aligned region: 32..177
Protein Sequence: 178 a.a.     [Download]
>gi|55418043|ref|YP_133943.1| TraF maturation peptidase precursor [uncultured bacterium]
MSRILKRIAAGVAIAGVAALLLAAGGYAAGARVNTTKSIPVGLYWTSSAPVEKGAYVLFCPPQLGVFDDA
KERGYIGAGFCEGGYGYMMKRVLAAKDDAVAVADDGVRVNGELLPLSAPIKADKAGRPLPRYQSNSYTLG
NSEVLLMSDVSATSFDGRYFGPINRSQIKTVIRPVITW
 
Nucleotide Sequence: 537 bp     [Download]
>gi|55418005|ref|NC_006388.1|:c41200-40664 Uncultured bacterium plasmid pB3 complete genome
ATGAGCCGCATCCTGAAACGTATCGCGGCAGGCGTCGCCATCGCGGGCGTGGCCGCCCTGCTGCTGGCGG
CCGGCGGCTATGCCGCCGGTGCCCGCGTGAACACCACCAAGAGCATTCCTGTCGGCCTGTACTGGACGAG
CAGCGCGCCGGTGGAGAAGGGGGCCTACGTCCTCTTCTGCCCGCCGCAGCTCGGCGTGTTCGATGACGCC
AAGGAGCGGGGCTACATCGGGGCCGGCTTCTGCGAGGGCGGCTACGGCTACATGATGAAGCGCGTTTTAG
CCGCTAAAGACGATGCCGTGGCCGTCGCCGATGACGGCGTGCGCGTCAACGGCGAGCTGCTGCCCCTCAG
CGCGCCGATCAAGGCCGACAAGGCCGGGCGGCCGCTGCCGCGCTACCAGTCCAACAGCTACACCCTCGGC
AATTCCGAGGTGCTGCTTATGTCGGACGTGAGCGCCACATCCTTCGACGGCCGCTACTTTGGCCCGATCA
ATCGTTCGCAAATCAAGACCGTGATTCGTCCGGTCATCACCTGGTAG
 Primer design