SecReT4
Protein ID: 55418044
T4SS name [ID]Trb [66]
Gene symboltraG
Locus tagpB3_p41
StrainPlasmid pB3
Repliconplasmid pB3 [GenBank: NC_006388] [Browse all T4SS(s) in this replicon]
Location [Strand]41197..43110 [-]
ProductDNA transport protein precursor
Component typeTraG
UniProt IDQ5W3G7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.1e-162, Aligned region: 121..620
TraG-D_C [PF12696], Evalue: 1.9e-32, Aligned region: 444..568
TrwB_AAD_bind [PF10412], Evalue: 1.6e-26, Aligned region: 177..568
Protein Sequence: 637 a.a.     [Download]
>gi|55418044|ref|YP_133944.1| DNA transport protein precursor [uncultured bacterium]
MKIKMNNAVGPQVRTAKPKPSKLLPVLGAASMVGGLQAATQFFAHTFAYHATLGPNVGHVYAPWSILHWT
YKWYSQYPDEIMKAGSMGMLVSTVGLLGVAVAKVVTSNSSKANEYLHGSARWAEKKDIQAAGLLPRERNV
LEIVTGKAAPTATGVYVGGWQDKDGNFFYLRHSGPEHVLTYAPTRSGKGVGLVVPTLLSWGASSVITDLK
GELWALTAGWRQKHAKNKVLRFEPASTSGGVCWNPLDEIRLGTEYEVGDVQNLATLIVDPDGKGLDSHWQ
KTAFALLVGVILHALYKAKDEGGTATLPSVDAMLADPNRDIGELWMEMATYGHVDGQNHHAIGSAARDMM
DRPEEEAGSVLSTAKSYLALYRDPVVARNVSRSDFRIKQLMHEDDPVSLYIVTQPNDKARLRPLVRVMVN
MIVRLLADKMDFEGGRPVAHYKHRLLMMLDEFPSLGKLEIMQESLAFVAGYGIKCYLICQDINQLKSRET
GYGHDESITSNCHVQNAYPPNRVETAEHLSRLTGQTTVVKEQITTSGRRTAAMLGQVSRTYQEVQRPLLT
PDECLRMPGPKKNAQGEIEEAGDMVIYVAGYPAIYGKQPLYFKDPVFSARAAIPAPKVSDRLRAVAQAET
EGEGITI
 
Nucleotide Sequence: 1914 bp     [Download]
>gi|55418005|ref|NC_006388.1|:c43110-41197 Uncultured bacterium plasmid pB3 complete genome
ATGAAGATCAAGATGAACAACGCGGTAGGGCCGCAAGTCCGAACCGCCAAACCGAAGCCGAGCAAGCTGC
TGCCGGTGCTGGGCGCGGCCTCGATGGTCGGCGGCCTCCAGGCCGCGACGCAGTTCTTCGCCCACACGTT
CGCCTATCACGCGACCCTCGGCCCCAACGTGGGCCACGTGTACGCGCCCTGGTCGATCCTGCACTGGACG
TACAAGTGGTACAGCCAGTACCCGGACGAGATCATGAAGGCCGGCAGCATGGGGATGCTGGTTTCGACCG
TGGGCCTGCTGGGCGTGGCCGTGGCGAAGGTCGTCACGTCCAACAGCTCGAAGGCGAACGAGTACCTGCA
CGGCTCGGCCCGCTGGGCCGAGAAGAAGGACATTCAGGCGGCCGGCCTGCTGCCGCGCGAGCGCAACGTC
CTGGAGATCGTCACCGGCAAGGCTGCACCCACGGCCACCGGCGTGTACGTGGGCGGCTGGCAAGACAAGG
ACGGCAATTTCTTCTACCTGCGGCACAGCGGCCCCGAGCACGTGCTGACCTACGCGCCCACGCGCTCGGG
CAAGGGCGTCGGCCTGGTGGTGCCGACGCTGCTGTCGTGGGGCGCGAGCAGCGTCATCACCGACTTGAAG
GGCGAGTTGTGGGCCTTGACCGCCGGCTGGCGGCAGAAGCACGCCAAGAACAAGGTGCTGCGCTTCGAGC
CGGCCAGCACTTCGGGCGGCGTCTGCTGGAACCCGCTGGACGAAATCCGCCTCGGCACTGAATACGAGGT
GGGCGACGTGCAGAACCTCGCCACGCTGATCGTTGACCCGGACGGCAAGGGCCTGGACTCGCACTGGCAG
AAAACCGCCTTCGCGCTCCTGGTCGGCGTGATCCTGCACGCGCTGTACAAGGCCAAGGACGAGGGCGGCA
CCGCCACGCTGCCGTCCGTCGATGCGATGCTGGCCGACCCGAACCGGGACATTGGCGAGCTTTGGATGGA
AATGGCGACCTACGGGCACGTAGACGGCCAGAACCATCACGCCATCGGCTCGGCGGCCCGCGACATGATG
GATCGCCCGGAGGAAGAAGCCGGCTCGGTGCTGTCCACGGCCAAGTCGTACCTGGCCCTGTACCGCGACC
CCGTGGTGGCCCGCAACGTCAGCCGGTCGGACTTCCGCATCAAGCAGTTGATGCACGAGGACGACCCGGT
AAGCCTCTACATCGTCACCCAGCCCAACGACAAGGCCCGCCTGCGGCCGCTGGTGCGCGTCATGGTGAAT
ATGATCGTGCGCCTGCTGGCCGACAAGATGGACTTCGAGGGCGGCCGCCCGGTAGCGCACTACAAGCACC
GGCTCTTGATGATGCTGGATGAGTTCCCGAGCCTCGGGAAGCTGGAGATCATGCAAGAGTCGCTGGCCTT
CGTGGCCGGCTACGGCATCAAGTGCTACCTCATCTGCCAGGACATTAACCAGCTCAAGAGCCGCGAGACG
GGCTACGGCCACGACGAAAGCATCACGTCGAACTGCCACGTGCAGAACGCCTATCCGCCCAACCGCGTCG
AGACGGCGGAACACCTGTCCCGCCTCACCGGGCAGACCACCGTGGTGAAGGAGCAGATCACGACCAGCGG
CCGCCGCACGGCGGCGATGCTGGGCCAGGTGTCGCGCACCTACCAGGAGGTGCAGCGGCCCTTGCTGACG
CCCGACGAATGCCTGCGCATGCCGGGGCCGAAGAAGAACGCCCAGGGCGAGATCGAAGAGGCCGGCGACA
TGGTGATCTACGTCGCGGGCTACCCGGCGATCTACGGCAAGCAACCCCTGTACTTCAAAGACCCGGTGTT
CTCGGCACGCGCCGCGATCCCCGCGCCCAAGGTCAGCGACCGCCTGCGCGCCGTCGCACAGGCCGAGACG
GAAGGGGAGGGCATCACGATATGA
 Primer design