SecReT4
Protein ID: 56416393
T4SS name [ID]VirB [496]
Gene symbolorfX
Locus tagAM030
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]23496..23882 [-]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5PBW7
KEGG IDama:AM030
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 7.5e-20, Aligned region: 5..100
Protein Sequence: 128 a.a.     [Download]
>gi|56416393|ref|YP_153467.1| hypothetical protein AM030 [Anaplasma marginale str. St. Maries]
MLLKLRFLLIAVVLAFGILHGVPAGASKSSEGAQTADDTATIVICNVIRFVQKLGLPIMTGVILGSSIMA
IFGKLAWPAIVMLVVFTAIFFGAGKLMAKFAKGLGGEGVKDAGSFDCSSYKGTAQSNR
 
Nucleotide Sequence: 387 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c23882-23496 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTGCTAAAACTTAGATTCTTACTCATTGCTGTAGTATTAGCATTTGGTATCTTACATGGTGTACCTG
CTGGGGCTAGTAAGTCCAGCGAGGGTGCTCAGACTGCTGATGATACAGCGACTATTGTTATATGTAACGT
TATACGGTTTGTGCAGAAGCTGGGACTACCCATCATGACTGGAGTGATACTAGGTTCTAGCATTATGGCT
ATCTTTGGTAAGCTTGCATGGCCTGCTATTGTAATGTTGGTTGTATTTACAGCTATATTCTTTGGTGCTG
GTAAGCTCATGGCTAAGTTTGCTAAGGGGTTGGGTGGTGAGGGTGTGAAGGATGCCGGTAGCTTTGACTG
TTCCAGTTATAAAGGCACTGCCCAAAGTAACCGATAG
 Primer design