SecReT4
Protein ID: 56416393
T4SS name [ID]VirB [496]
Gene symbolorfX
Locus tagAM030
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]23496..23882 [-]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5PBW7
KEGG IDama:AM030
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 7.5e-20, Aligned region: 5..100
Protein Sequence: 128 a.a.     [Download]
>gi|56416393|ref|YP_153467.1| hypothetical protein AM030 [Anaplasma marginale str. St. Maries]
MLLKLRFLLIAVVLAFGILHGVPAGASKSSEGAQTADDTATIVICNVIRFVQKLGLPIMTGVILGSSIMA
IFGKLAWPAIVMLVVFTAIFFGAGKLMAKFAKGLGGEGVKDAGSFDCSSYKGTAQSNR
 
Nucleotide Sequence: 387 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c23882-23496 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTGCTAAAACTTAGATTCTTACTCATTGCTGTAGTATTAGCATTTGGTATCTTACATGGTGTACCTG
CTGGGGCTAGTAAGTCCAGCGAGGGTGCTCAGACTGCTGATGATACAGCGACTATTGTTATATGTAACGT
TATACGGTTTGTGCAGAAGCTGGGACTACCCATCATGACTGGAGTGATACTAGGTTCTAGCATTATGGCT
ATCTTTGGTAAGCTTGCATGGCCTGCTATTGTAATGTTGGTTGTATTTACAGCTATATTCTTTGGTGCTG
GTAAGCTCATGGCTAAGTTTGCTAAGGGGTTGGGTGGTGAGGGTGTGAAGGATGCCGGTAGCTTTGACTG
TTCCAGTTATAAAGGCACTGCCCAAAGTAACCGATAG
 Primer design

Protein ID: 56416394
T4SS name [ID]VirB [496]
Gene symbolorfY
Locus tagAM032
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]23955..24188 [-]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5PBV7
KEGG IDama:AM032, ama:AM046
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.9e-08, Aligned region: 2..60
Protein Sequence: 77 a.a.     [Download]
>gi|56416394|ref|YP_153468.1| hypothetical protein AM032 [Anaplasma marginale str. St. Maries]
MVALIWLFITAGSTNADTISSTNTADDTATKVICDVIVFVQKLGLPIMTGVVLGSGVMAWHTCMACHGNA
GCVYSHR
 
Nucleotide Sequence: 234 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c24188-23955 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGGTAGCCCTGATATGGTTATTCATCACAGCAGGTTCTACTAATGCCGATACTATCAGCAGTACTAACA
CTGCTGACGATACAGCTACCAAGGTTATTTGTGACGTCATTGTCTTCGTGCAGAAGCTGGGATTACCCAT
CATGACAGGGGTGGTACTAGGTTCTGGCGTCATGGCTTGGCACACTTGCATGGCCTGCCATGGTAATGCT
GGTTGTGTGTACAGCCATAGGTAA
 Primer design

Protein ID: 56416402
T4SS name [ID]VirB [496]
Gene symbolorfX
Locus tagAM044
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]33143..33541 [-]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5PBV8
KEGG IDama:AM044
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5.3e-19, Aligned region: 7..104
Protein Sequence: 132 a.a.     [Download]
>gi|56416402|ref|YP_153476.1| hypothetical protein AM044 [Anaplasma marginale str. St. Maries]
MLLKLRFLLIAVVLALGILHGVPAAGATGAQASPSPSTEADDTATVVICNVIRFVQKLGLPIMTGVILGS
SIMAIFGKLAWPAIVMLVVFTAIFFGAGKLMAKFAAGLSGEGMENAGKFDCASHKGTAQSNR
 
Nucleotide Sequence: 399 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c33541-33143 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTGCTAAAACTTAGATTCTTACTCATTGCTGTAGTATTAGCATTGGGTATCTTACATGGTGTACCTG
CTGCAGGGGCTACTGGTGCTCAGGCGAGCCCTAGTCCCAGTACTGAAGCTGATGATACAGCGACTGTTGT
TATATGTAACGTTATACGGTTTGTGCAGAAGCTGGGACTACCTATCATGACTGGGGTGATATTGGGTTCT
AGCATTATGGCCATCTTTGGTAAGCTTGCATGGCCTGCTATTGTGATGTTGGTTGTATTTACAGCGATAT
TCTTTGGTGCTGGTAAGCTTATGGCTAAATTTGCTGCCGGACTTAGTGGTGAAGGCATGGAGAATGCTGG
TAAGTTTGACTGTGCCAGTCATAAAGGCACTGCCCAAAGTAACCGATAG
 Primer design

Protein ID: 56416403
T4SS name [ID]VirB [496]
Gene symbolorfY
Locus tagAM046
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]33614..33847 [-]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5PBV7
KEGG IDama:AM032, ama:AM046
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.9e-08, Aligned region: 2..60
Protein Sequence: 77 a.a.     [Download]
>gi|56416403|ref|YP_153477.1| hypothetical protein AM046 [Anaplasma marginale str. St. Maries]
MVALIWLFITAGSTNADTISSTNTADDTATKVICDVIVFVQKLGLPIMTGVVLGSGVMAWHTCMACHGNA
GCVYSHR
 
Nucleotide Sequence: 234 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c33847-33614 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGGTAGCCCTGATATGGTTATTCATCACAGCAGGTTCTACTAATGCCGATACTATCAGCAGTACTAACA
CTGCTGACGATACAGCTACCAAGGTTATTTGTGACGTCATTGTCTTCGTGCAGAAGCTGGGATTACCCAT
CATGACAGGGGTGGTACTAGGTTCTGGCGTCATGGCTTGGCACACTTGCATGGCCTGCCATGGTAATGCT
GGTTGTGTGTACAGCCATAGGTAA
 Primer design

Protein ID: 56416413
T4SS name [ID]VirB [496]
Gene symbolorfY
Locus tagAM063
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]47834..48067 [+]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5P9H0
KEGG IDama:AM063, ama:AM1251
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.7e-08, Aligned region: 2..60
Protein Sequence: 77 a.a.     [Download]
>gi|56416413|ref|YP_153487.1| hypothetical protein AM063 [Anaplasma marginale str. St. Maries]
MVALIWLFITAGSTNADTISSTNTADDTATKVICDVIVFVQKLGLPIMTGVVLGSGVMAWHTCMACYCNA
GCVYSHR
 
Nucleotide Sequence: 234 bp     [Download]
>gi|56416370|ref|NC_004842.2|:47834-48067 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGGTAGCCCTGATATGGTTATTCATCACAGCAGGTTCTACTAATGCCGATACTATCAGCAGTACTAACA
CTGCTGACGATACAGCTACCAAGGTTATTTGTGACGTCATTGTCTTCGTGCAGAAGCTGGGATTACCCAT
CATGACAGGGGTGGTACTAGGTTCTGGCGTCATGGCTTGGCACACTTGCATGGCCTGCTATTGTAATGCT
GGTTGTGTGTACAGCCATAGGTAA
 Primer design

Protein ID: 56416414
T4SS name [ID]VirB [496]
Gene symbolorfX
Locus tagAM065
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]48140..48535 [+]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5PBU6
KEGG IDama:AM065
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5.2e-19, Aligned region: 7..104
Protein Sequence: 131 a.a.     [Download]
>gi|56416414|ref|YP_153488.1| hypothetical protein AM065 [Anaplasma marginale str. St. Maries]
MLLKLRFLLIAVVLALGILHGVPAAGATGAQASPSPSTEADDTATVVICNVIRFVQKLGLPIMTGVILGS
SIMAIFGKLAWPAIVMLVVFTAIFFGAGKLMAKFAAGLSGEGVKDADKFDCASHTGQGGRT
 
Nucleotide Sequence: 396 bp     [Download]
>gi|56416370|ref|NC_004842.2|:48140-48535 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTGCTAAAACTTAGATTCTTACTCATTGCTGTAGTATTAGCATTGGGTATCTTACATGGTGTACCTG
CTGCAGGGGCTACTGGTGCTCAGGCGAGCCCTAGTCCCAGTACTGAAGCTGATGATACAGCGACTGTTGT
TATATGTAACGTTATACGGTTTGTGCAGAAGCTGGGACTACCTATCATGACTGGGGTGATATTGGGTTCT
AGCATTATGGCCATCTTTGGTAAGCTTGCATGGCCTGCTATTGTGATGTTGGTTGTATTTACAGCGATAT
TCTTTGGTGCTGGTAAGCTTATGGCTAAATTTGCTGCCGGACTTAGTGGTGAAGGTGTGAAGGATGCCGA
TAAGTTTGACTGTGCCAGTCATACTGGGCAAGGAGGCCGGACTTAG
 Primer design

Protein ID: 56416422
T4SS name [ID]VirB [496]
Gene symbolorfX
Locus tagAM077
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]64841..65242 [-]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5PBT8
KEGG IDama:AM077
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.9e-19, Aligned region: 6..103
Protein Sequence: 133 a.a.     [Download]
>gi|56416422|ref|YP_153496.1| hypothetical protein AM077 [Anaplasma marginale str. St. Maries]
MLLKLRFLLIAGVLALGILHGVPAGAAAQASPSTTGTEADDTATVVICNVIRFVQKLGLPIMTGVILGSS
IMAIFGKLAWPAIVMLVVFTAIFFGAGKLMAKFAKGLSGDGIGDASKFDCSQHTAVNTSQSNR
 
Nucleotide Sequence: 402 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c65242-64841 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTGCTAAAACTTAGATTCTTACTCATTGCTGGAGTATTAGCATTGGGTATCTTACATGGTGTACCTG
CAGGGGCTGCTGCTCAGGCGAGCCCTAGTACTACTGGTACTGAAGCTGATGATACAGCGACTGTTGTTAT
ATGCAATGTTATACGGTTTGTGCAGAAGCTGGGACTACCCATCATGACTGGGGTGATACTAGGTTCTAGC
ATTATGGCTATCTTTGGTAAGCTTGCATGGCCTGCTATTGTAATGCTGGTTGTATTTACAGCTATATTCT
TTGGTGCTGGTAAGCTCATGGCTAAATTTGCTAAGGGGTTGAGTGGTGATGGCATAGGTGATGCCAGTAA
GTTTGACTGTTCACAGCATACAGCGGTCAACACCAGCCAAAGTAACCGATAG
 Primer design

Protein ID: 56416423
T4SS name [ID]VirB [496]
Gene symbolorfX
Locus tagAM082
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]67571..67978 [+]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5PBT7
KEGG IDama:AM082
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.5e-17, Aligned region: 27..107
Protein Sequence: 135 a.a.     [Download]
>gi|56416423|ref|YP_153497.1| hypothetical protein AM082 [Anaplasma marginale str. St. Maries]
MLLKLRFLLIAVVLALGILHGVPAAGAAAGAASGSSAGTTQAADDTATVVICNVIRFVQKLGLPIMTGVI
LGSSIMAIFGKLAWPAIVMLVVFTAIFFGAGKLMAKFAKGVGDVGGKSAESFDCSQHTAVNTKQS
 
Nucleotide Sequence: 408 bp     [Download]
>gi|56416370|ref|NC_004842.2|:67571-67978 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTGCTAAAACTTAGATTCTTACTAATTGCTGTAGTATTAGCATTGGGTATCTTACATGGTGTACCTG
CTGCAGGGGCTGCTGCAGGGGCTGCTAGCGGTAGCAGTGCAGGGACTACTCAGGCTGCTGACGATACAGC
GACTGTTGTTATATGTAACGTTATACGGTTTGTGCAGAAGCTGGGACTACCCATCATGACTGGAGTGATA
CTAGGTTCTAGCATTATGGCTATCTTTGGTAAGCTTGCATGGCCTGCTATTGTAATGCTGGTTGTATTTA
CAGCTATATTCTTTGGTGCTGGTAAGCTCATGGCTAAATTTGCCAAAGGTGTAGGTGATGTGGGAGGAAA
GAGCGCCGAGAGCTTTGACTGTTCACAGCATACAGCGGTCAACACCAAGCAAAGCTAA
 Primer design

Protein ID: 56416511
T4SS name [ID]VirB [496]
Gene symbolorfX
Locus tagAM210
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]175825..176214 [+]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5PBJ9
KEGG IDama:AM210
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 9.5e-20, Aligned region: 5..100
Protein Sequence: 129 a.a.     [Download]
>gi|56416511|ref|YP_153585.1| hypothetical protein AM210 [Anaplasma marginale str. St. Maries]
MLLKLRFLLIAVVLAFGILHGVPAGASKSSEGAQTADDTATIVICNVIGFVQKLGLPIMTGVILGSSIMA
IFGKLAWPAIVMLVVFTAIFFGAGKLMAKFAAGLGDVGGGTDASKFDCASHKGSSGAAG
 
Nucleotide Sequence: 390 bp     [Download]
>gi|56416370|ref|NC_004842.2|:175825-176214 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTGCTAAAACTTAGATTCTTACTCATTGCTGTAGTATTAGCATTTGGTATCTTACATGGTGTACCTG
CTGGGGCTAGTAAGTCCAGCGAGGGTGCTCAGACTGCTGATGATACAGCGACTATTGTTATATGTAATGT
TATAGGGTTTGTACAGAAGCTGGGACTACCCATCATGACTGGGGTGATACTAGGTTCTAGCATTATGGCT
ATCTTTGGTAAGCTTGCATGGCCTGCTATTGTGATGTTGGTTGTATTTACAGCTATATTCTTTGGTGCTG
GTAAGCTTATGGCTAAGTTTGCTGCTGGATTGGGCGATGTGGGAGGAGGAACGGATGCCAGTAAGTTTGA
CTGTGCCAGTCATAAAGGTAGCAGTGGTGCTGCTGGGTAG
 Primer design

Protein ID: 56416859
T4SS name [ID]VirB [496]
Gene symbolorfX
Locus tagAM717
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]659399..659770 [-]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5PAK2
KEGG IDama:AM717
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.9e-20, Aligned region: 5..95
Protein Sequence: 123 a.a.     [Download]
>gi|56416859|ref|YP_153933.1| hypothetical protein AM717 [Anaplasma marginale str. St. Maries]
MLLKLRFLLIAGVLAFGILHGVPAGAEAAKDDDTATVVICNVIRFVQKLGLPIMTGVILGSSIMAIFGKL
AWPAIVMLVVFTAIFFGAGKLMAKFAKGLGGENENFDCAQHTAVNSSPKPAKP
 
Nucleotide Sequence: 372 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c659770-659399 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTGCTAAAACTTAGATTCTTACTCATTGCTGGAGTATTAGCATTTGGTATCTTACATGGTGTACCTG
CTGGGGCTGAGGCTGCTAAGGATGATGATACAGCGACTGTTGTTATATGTAACGTTATACGGTTTGTGCA
GAAGCTGGGACTACCCATCATGACTGGAGTGATACTAGGTTCTAGCATTATGGCTATCTTTGGTAAGCTT
GCATGGCCTGCTATTGTAATGTTGGTTGTATTTACAGCTATATTCTTTGGTGCTGGTAAGCTTATGGCTA
AGTTTGCTAAGGGGTTGGGTGGCGAAAATGAGAACTTCGACTGTGCACAGCATACAGCAGTCAACAGCAG
CCCCAAGCCAGCCAAGCCCTAA
 Primer design

Protein ID: 56416860
T4SS name [ID]VirB [496]
Gene symbolorfY
Locus tagAM721
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]662843..663076 [+]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5PAK1
KEGG IDama:AM721
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.8e-08, Aligned region: 2..60
Protein Sequence: 77 a.a.     [Download]
>gi|56416860|ref|YP_153934.1| hypothetical protein AM721 [Anaplasma marginale str. St. Maries]
MVALIWLFITAGSTNADTISSTNTADDTATKVICDVIVFVQKLGLPIMTGVVLGSGVMAWHTCMACHGNA
GCMYSHR
 
Nucleotide Sequence: 234 bp     [Download]
>gi|56416370|ref|NC_004842.2|:662843-663076 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGGTAGCCCTGATATGGTTATTCATCACAGCAGGTTCTACTAATGCCGATACTATCAGCAGTACTAACA
CTGCTGACGATACAGCTACCAAGGTTATTTGTGACGTCATTGTCTTCGTGCAGAAGCTGGGATTACCCAT
CATGACAGGGGTGGTACTAGGTTCTGGCGTCATGGCTTGGCACACTTGCATGGCCTGCCATGGTAATGCT
GGTTGTATGTACAGCCATAGGTAA
 Primer design

Protein ID: 56416861
T4SS name [ID]VirB [496]
Gene symbolorfX
Locus tagAM723
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]663149..663547 [+]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5PAK0
KEGG IDama:AM723
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.1e-18, Aligned region: 5..102
Protein Sequence: 132 a.a.     [Download]
>gi|56416861|ref|YP_153935.1| hypothetical protein AM723 [Anaplasma marginale str. St. Maries]
MLLKLRFLLIAVVLALGILHGVPAAGATGAGTTQAAKDDDTATVVICNVIRFVQKLGLPIMTGVILGSSI
MAIFGKLAWPAIVMLVVFTAIFFGAGKLMAKFAKGLGGENENFDCAQHTAVNSSPKPAKPLS
 
Nucleotide Sequence: 399 bp     [Download]
>gi|56416370|ref|NC_004842.2|:663149-663547 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTGCTAAAACTTAGATTCTTACTCATTGCTGTAGTATTAGCATTGGGTATCTTACATGGTGTACCTG
CTGCAGGGGCTACTGGTGCAGGGACTACTCAGGCTGCTAAGGATGACGATACAGCGACTGTTGTTATATG
TAACGTTATACGGTTTGTGCAGAAGCTGGGACTACCCATCATGACTGGAGTGATACTAGGTTCTAGCATT
ATGGCTATCTTTGGTAAGCTTGCATGGCCTGCTATTGTAATGTTAGTTGTATTCACAGCTATATTCTTTG
GTGCTGGTAAGCTCATGGCTAAGTTTGCTAAGGGGTTGGGTGGCGAAAATGAGAACTTCGACTGTGCACA
GCATACAGCAGTCAACAGCAGCCCCAAGCCAGCCAAGCCCTTAAGTTAG
 Primer design

Protein ID: 56417061
T4SS name [ID]VirB [496]
Gene symbolorfX
Locus tagAM989
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]900783..901157 [-]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5PA00
KEGG IDama:AM989
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.7e-20, Aligned region: 5..97
Protein Sequence: 124 a.a.     [Download]
>gi|56417061|ref|YP_154135.1| hypothetical protein AM989 [Anaplasma marginale str. St. Maries]
MLLKLRFLLIAVVLALGILHGVPAGADTQTAKDDDTATVVICNVIRFVQKLGLPIMTGVILGSSIMAIFG
KLAWPAIVMLVVFTAIFFGAGKLMAKFASGLGDVGGGTKAESFDCSSYKEVKAK
 
Nucleotide Sequence: 375 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c901157-900783 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTGCTAAAACTTAGATTCTTACTCATTGCTGTAGTATTAGCATTGGGTATCTTACATGGTGTACCTG
CAGGGGCTGATACTCAGACTGCTAAGGATGACGATACAGCGACTGTTGTTATATGTAACGTTATACGGTT
TGTGCAGAAGCTTGGGCTTCCTATCATGACTGGAGTGATACTAGGTTCTAGCATTATGGCTATCTTTGGT
AAGCTTGCATGGCCTGCTATTGTGATGCTAGTTGTATTCACAGCTATATTCTTTGGTGCTGGTAAGCTCA
TGGCTAAATTTGCTTCCGGGTTGGGCGATGTGGGAGGAGGCACGAAGGCCGAGAGCTTTGACTGTTCCAG
TTATAAGGAAGTCAAGGCCAAGTAA
 Primer design

Protein ID: 56417062
T4SS name [ID]VirB [496]
Gene symbolorfY
Locus tagAM990
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]901157..901468 [-]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5P9Z9
KEGG IDama:AM990
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 9e-14, Aligned region: 2..78
Protein Sequence: 103 a.a.     [Download]
>gi|56417062|ref|YP_154136.1| hypothetical protein AM990 [Anaplasma marginale str. St. Maries]
MVALIWLFITAGSTNADTISSTNIADDTATKVICDVIVFVQKLGLPIMTGVILGSSIMAIFGKLAWPAIV
MLVVFTAIGKLMATVLRVIPVSARVDVEVLGEW
 
Nucleotide Sequence: 312 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c901468-901157 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGGTAGCCCTGATATGGTTATTCATCACAGCAGGTTCTACTAATGCCGATACTATCAGCAGTACTAACA
TTGCTGACGATACAGCTACCAAGGTTATTTGTGACGTCATTGTCTTCGTGCAGAAGCTGGGATTACCCAT
CATGACAGGGGTGATACTAGGTTCTAGCATTATGGCTATCTTTGGTAAGCTTGCATGGCCTGCTATTGTA
ATGCTGGTTGTATTTACAGCTATAGGTAAGCTTATGGCCACTGTATTGAGGGTAATACCAGTTAGTGCAA
GGGTGGACGTAGAGGTTTTGGGAGAGTGGTGA
 Primer design

Protein ID: 56417101
T4SS name [ID]VirB [496]
Gene symbol-
Locus tagAM1054
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]958771..959145 [-]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5P9W0
KEGG IDama:AM1054
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.3e-19, Aligned region: 5..102
Protein Sequence: 124 a.a.     [Download]
>gi|56417101|ref|YP_154175.1| hypothetical protein AM1054 [Anaplasma marginale str. St. Maries]
MLKAFLTTVSVFVFTLLSFSSEASSVRAMSQGSANAANGEVVSKVICNVVVFVQKLGLPIMTGVILGSSI
MAVFGRLAWPAIVMLVVFTAIFFGAGKLISKFAGGIAELGADDFDCRVLAGTTI
 
Nucleotide Sequence: 375 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c959145-958771 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTGAAAGCCTTTTTGACAACAGTATCTGTGTTTGTCTTCACGTTACTATCGTTCAGCTCTGAAGCCT
CAAGCGTGCGCGCTATGTCCCAGGGTTCAGCAAATGCGGCGAATGGGGAAGTGGTATCAAAAGTTATATG
CAACGTTGTGGTGTTCGTGCAAAAGTTGGGGTTGCCTATAATGACGGGAGTTATACTGGGCTCGAGCATC
ATGGCGGTCTTCGGTAGGCTGGCATGGCCTGCTATTGTGATGCTAGTTGTATTTACAGCCATATTCTTTG
GTGCAGGGAAGTTGATTTCAAAATTTGCCGGTGGCATTGCAGAATTGGGTGCTGATGATTTTGACTGTAG
AGTGCTTGCTGGCACGACTATATAG
 Primer design

Protein ID: 56417102
T4SS name [ID]VirB [496]
Gene symbol-
Locus tagAM1055
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]959418..959795 [-]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5P9V9
KEGG IDama:AM1055
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 9.5e-24, Aligned region: 8..110
Protein Sequence: 125 a.a.     [Download]
>gi|56417102|ref|YP_154176.1| hypothetical protein AM1055 [Anaplasma marginale str. St. Maries]
MGVYGMSRFVKFFFRAACTLLVALSIGTADCAFASDKGKTGGQDDKKDVATTVICNVILFVQKLGLPIMT
GVILGASVMAVFGRLAWPAIAMLVVFTAIFFGASKLISKFAKGITELDADNFDCK
 
Nucleotide Sequence: 378 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c959795-959418 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGGGGGTTTATGGAATGTCACGATTTGTAAAATTTTTCTTTCGGGCAGCATGTACACTATTAGTTGCGC
TCAGCATCGGTACCGCAGACTGCGCCTTCGCGAGCGATAAAGGGAAGACGGGGGGACAGGATGATAAAAA
AGATGTTGCCACAACAGTGATATGTAATGTCATCCTCTTTGTGCAAAAGCTGGGGTTACCGATCATGACC
GGTGTTATTCTAGGCGCAAGTGTAATGGCGGTTTTCGGTAGGCTGGCATGGCCGGCCATAGCAATGTTGG
TTGTATTTACTGCAATATTCTTTGGCGCAAGTAAGCTCATAAGCAAATTTGCGAAGGGGATCACCGAGCT
AGACGCCGATAACTTTGACTGCAAGTAA
 Primer design

Protein ID: 56417103
T4SS name [ID]VirB [496]
Gene symbol-
Locus tagAM1056
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]960582..961172 [-]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5P9V8
KEGG IDama:AM1056
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 8.1e-16, Aligned region: 116..183
GRP [PF07172], Evalue: 9.5e-05, Aligned region: 29..118
Protein Sequence: 196 a.a.     [Download]
>gi|56417103|ref|YP_154177.1| hypothetical protein AM1056 [Anaplasma marginale str. St. Maries]
MFTRERKVTCCLLLKRFGGAMYAVAPKVLLFLVFLFVVDSAHAASNKNAGNNKSKSTSSKSVSGSKSKSV
SSSKSKSAGSTNVGTANQFPALGGGGSGSGNTGSGSGGGTGGGGGGANDDMVAGKVICNVISFVRAIGLP
IMTGVILGSSIMAIFGRLAWPAIAILVVFTGVFFGADKLVKKFADGVGPTSVFSCT
 
Nucleotide Sequence: 591 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c961172-960582 Anaplasma marginale str. St. Maries chromosome, complete genome
TTGTTTACTAGGGAGAGGAAAGTGACTTGTTGTTTGTTATTGAAGCGTTTCGGAGGTGCTATGTACGCCG
TAGCGCCGAAGGTATTGTTATTTTTGGTGTTCCTGTTCGTTGTCGATTCGGCGCATGCTGCTAGTAATAA
GAATGCTGGCAATAATAAGAGTAAGAGCACGAGCAGTAAGAGTGTAAGCGGTAGTAAGAGTAAAAGTGTG
AGCAGTAGTAAGAGTAAAAGTGCCGGCAGTACGAATGTCGGTACTGCCAATCAGTTTCCTGCTTTGGGTG
GTGGAGGCTCAGGTAGTGGTAATACAGGCTCAGGTAGTGGAGGAGGCACAGGTGGCGGCGGTGGCGGCGC
CAACGATGATATGGTTGCCGGCAAAGTCATCTGTAATGTAATCAGTTTCGTTAGGGCTATAGGGTTGCCA
ATCATGACTGGGGTGATATTAGGCTCTAGCATCATGGCAATTTTCGGCAGATTGGCATGGCCTGCAATAG
CCATACTAGTAGTGTTTACCGGAGTGTTTTTTGGAGCGGATAAACTGGTTAAGAAATTTGCCGATGGTGT
TGGTCCGACATCCGTATTTTCGTGCACATAG
 Primer design

Protein ID: 56417106
T4SS name [ID]VirB [496]
Gene symbolorfY
Locus tagAM1059
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]962297..962566 [+]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5P9V5
KEGG IDama:AM1059
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.2e-09, Aligned region: 6..72
Protein Sequence: 89 a.a.     [Download]
>gi|56417106|ref|YP_154180.1| hypothetical protein AM1059 [Anaplasma marginale str. St. Maries]
MFNFARRYLAPAMVALIWLFITAGSTNADTISSTNTADDTATKVICDVIVFVQKLGLPIMTGVVLGSGVM
AWHTCMACYCNAGCVYSHR
 
Nucleotide Sequence: 270 bp     [Download]
>gi|56416370|ref|NC_004842.2|:962297-962566 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTCAACTTTGCACGAAGATACCTAGCTCCTGCTATGGTAGCCCTGATATGGTTATTCATCACAGCAG
GTTCTACTAATGCCGATACTATCAGCAGTACTAACACTGCTGACGATACAGCTACCAAGGTTATTTGTGA
CGTCATTGTCTTCGTGCAGAAGCTGGGATTACCCATCATGACAGGGGTGGTACTAGGTTCTGGCGTCATG
GCTTGGCACACTTGCATGGCCTGCTATTGTAATGCTGGTTGTGTGTACAGCCATAGGTAA
 Primer design

Protein ID: 56417107
T4SS name [ID]VirB [496]
Gene symbolorfX
Locus tagAM1061
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]962633..963028 [+]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5P9V4
KEGG IDama:AM1061
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 9.1e-20, Aligned region: 6..102
Protein Sequence: 131 a.a.     [Download]
>gi|56417107|ref|YP_154181.1| hypothetical protein AM1061 [Anaplasma marginale str. St. Maries]
MVMLLKLRFLLIAVVLALGILHGVPAGASKSSEGAQTADDTATIVICNVIRFVQKLGLPIMTGVILGSSI
MAIFGKLAWPAIVMLVVFTAIFFGAGKLMAKFAAGLGDVGGGTDASKFDCASHKGSSGAAG
 
Nucleotide Sequence: 396 bp     [Download]
>gi|56416370|ref|NC_004842.2|:962633-963028 Anaplasma marginale str. St. Maries chromosome, complete genome
GTGGTGATGTTGCTAAAACTTAGATTCTTACTCATTGCTGTAGTATTAGCATTGGGTATCTTACATGGTG
TACCTGCTGGGGCTAGTAAGTCCAGCGAGGGTGCTCAGACTGCTGATGATACAGCGACTATTGTTATATG
TAACGTTATACGGTTTGTGCAGAAGCTGGGACTACCCATCATGACTGGAGTGATACTAGGTTCTAGCATT
ATGGCTATCTTTGGTAAGCTTGCATGGCCTGCTATTGTGATGTTGGTTGTATTTACAGCTATATTCTTTG
GTGCTGGTAAGCTTATGGCTAAGTTTGCTGCTGGATTGGGCGATGTGGGAGGAGGAACGGATGCCAGTAA
GTTTGACTGTGCCAGTCATAAAGGTAGCAGTGGTGCTGCTGGGTAG
 Primer design

Protein ID: 56417174
T4SS name [ID]VirB [496]
Gene symbolorfX
Locus tagAM1149
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]1034507..1034896 [-]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5P9N7
KEGG IDama:AM1149
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.5e-19, Aligned region: 6..101
Protein Sequence: 129 a.a.     [Download]
>gi|56417174|ref|YP_154248.1| hypothetical protein AM1149 [Anaplasma marginale str. St. Maries]
MLLKLRFLLIAVVLALGILHGVPAGAENVQAGQAAKDDDTATVVICNVIRFVQKLGLPIMTGVILGSSIM
AIFGKLAWPAIVMLVVFTAIFFGAGKLMAKFAAGLSGEGVKDAGSFDCSSYKGTAQSNR
 
Nucleotide Sequence: 390 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c1034896-1034507 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTGCTAAAACTTAGATTCTTACTCATTGCTGTAGTATTAGCATTGGGTATCTTACATGGTGTACCTG
CAGGGGCTGAGAATGTTCAGGCTGGTCAGGCTGCTAAGGATGATGACACAGCAACCGTTGTTATATGCAA
TGTTATACGGTTTGTGCAGAAGCTGGGACTACCCATCATGACTGGAGTGATACTAGGTTCTAGCATTATG
GCTATCTTTGGTAAGCTTGCATGGCCTGCTATTGTAATGCTGGTTGTATTTACAGCTATATTCTTTGGTG
CTGGTAAGCTTATGGCTAAATTTGCTGCTGGGTTGAGTGGTGAGGGTGTGAAGGATGCCGGTAGCTTTGA
CTGTTCCAGTTATAAAGGCACTGCCCAAAGTAACCGATAG
 Primer design

Protein ID: 56417241
T4SS name [ID]VirB [496]
Gene symbolorfY
Locus tagAM1251
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]1113315..1113548 [+]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5P9H0
KEGG IDama:AM063, ama:AM1251
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.7e-08, Aligned region: 2..60
Protein Sequence: 77 a.a.     [Download]
>gi|56417241|ref|YP_154315.1| hypothetical protein AM1251 [Anaplasma marginale str. St. Maries]
MVALIWLFITAGSTNADTISSTNTADDTATKVICDVIVFVQKLGLPIMTGVVLGSGVMAWHTCMACYCNA
GCVYSHR
 
Nucleotide Sequence: 234 bp     [Download]
>gi|56416370|ref|NC_004842.2|:1113315-1113548 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGGTAGCCCTGATATGGTTATTCATCACAGCAGGTTCTACTAATGCCGATACTATCAGCAGTACTAACA
CTGCTGACGATACAGCTACCAAGGTTATTTGTGACGTCATTGTCTTCGTGCAGAAGCTGGGATTACCCAT
CATGACAGGGGTGGTACTAGGTTCTGGCGTCATGGCTTGGCACACTTGCATGGCCTGCTATTGTAATGCT
GGTTGTGTGTACAGCCATAGGTAA
 Primer design

Protein ID: 56417242
T4SS name [ID]VirB [496]
Gene symbolorfX
Locus tagAM1253
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]1113621..1114010 [+]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5P9G9
KEGG IDama:AM1253
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.9e-19, Aligned region: 7..104
Protein Sequence: 129 a.a.     [Download]
>gi|56417242|ref|YP_154316.1| hypothetical protein AM1253 [Anaplasma marginale str. St. Maries]
MLLKLRFLLIAVVLALGILHGVPAAGATGAQASPSPSTEADDTATVVICNVIRFVQKLGLPIMTGVILGS
SIMAIFGKLAWPAIVMLVVFTAIFFGAGKLMAKFAAGLSGEGMENAGKFDCASHTSAKT
 
Nucleotide Sequence: 390 bp     [Download]
>gi|56416370|ref|NC_004842.2|:1113621-1114010 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTGCTAAAACTTAGATTCTTACTCATTGCTGTAGTATTAGCATTGGGTATCTTACATGGTGTACCTG
CTGCAGGGGCTACTGGTGCTCAGGCGAGCCCTAGTCCCAGTACTGAAGCTGATGATACAGCGACTGTTGT
TATATGTAACGTTATACGGTTTGTGCAGAAGCTGGGACTACCTATCATGACTGGGGTGATATTGGGTTCT
AGCATTATGGCCATCTTTGGTAAGCTTGCATGGCCTGCTATTGTGATGTTGGTTGTATTTACAGCGATAT
TCTTTGGTGCTGGTAAGCTTATGGCTAAATTTGCTGCCGGACTTAGTGGTGAAGGCATGGAGAATGCTGG
TAAGTTTGACTGTGCCAGTCATACGAGTGCCAAGACTTAG
 Primer design