SecReT4
Protein ID: 56416394
T4SS name [ID]VirB [496]
Gene symbolorfY
Locus tagAM032
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]23955..24188 [-]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5PBV7
KEGG IDama:AM032, ama:AM046
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.9e-08, Aligned region: 2..60
Protein Sequence: 77 a.a.     [Download]
>gi|56416394|ref|YP_153468.1| hypothetical protein AM032 [Anaplasma marginale str. St. Maries]
MVALIWLFITAGSTNADTISSTNTADDTATKVICDVIVFVQKLGLPIMTGVVLGSGVMAWHTCMACHGNA
GCVYSHR
 
Nucleotide Sequence: 234 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c24188-23955 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGGTAGCCCTGATATGGTTATTCATCACAGCAGGTTCTACTAATGCCGATACTATCAGCAGTACTAACA
CTGCTGACGATACAGCTACCAAGGTTATTTGTGACGTCATTGTCTTCGTGCAGAAGCTGGGATTACCCAT
CATGACAGGGGTGGTACTAGGTTCTGGCGTCATGGCTTGGCACACTTGCATGGCCTGCCATGGTAATGCT
GGTTGTGTGTACAGCCATAGGTAA
 Primer design