SecReT4
Protein ID: 56416402
T4SS name [ID]VirB [496]
Gene symbolorfX
Locus tagAM044
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]33143..33541 [-]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5PBV8
KEGG IDama:AM044
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5.3e-19, Aligned region: 7..104
Protein Sequence: 132 a.a.     [Download]
>gi|56416402|ref|YP_153476.1| hypothetical protein AM044 [Anaplasma marginale str. St. Maries]
MLLKLRFLLIAVVLALGILHGVPAAGATGAQASPSPSTEADDTATVVICNVIRFVQKLGLPIMTGVILGS
SIMAIFGKLAWPAIVMLVVFTAIFFGAGKLMAKFAAGLSGEGMENAGKFDCASHKGTAQSNR
 
Nucleotide Sequence: 399 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c33541-33143 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTGCTAAAACTTAGATTCTTACTCATTGCTGTAGTATTAGCATTGGGTATCTTACATGGTGTACCTG
CTGCAGGGGCTACTGGTGCTCAGGCGAGCCCTAGTCCCAGTACTGAAGCTGATGATACAGCGACTGTTGT
TATATGTAACGTTATACGGTTTGTGCAGAAGCTGGGACTACCTATCATGACTGGGGTGATATTGGGTTCT
AGCATTATGGCCATCTTTGGTAAGCTTGCATGGCCTGCTATTGTGATGTTGGTTGTATTTACAGCGATAT
TCTTTGGTGCTGGTAAGCTTATGGCTAAATTTGCTGCCGGACTTAGTGGTGAAGGCATGGAGAATGCTGG
TAAGTTTGACTGTGCCAGTCATAAAGGCACTGCCCAAAGTAACCGATAG
 Primer design