SecReT4
Protein ID: 56416413
T4SS name [ID]VirB [496]
Gene symbolorfY
Locus tagAM063
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]47834..48067 [+]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5P9H0
KEGG IDama:AM063, ama:AM1251
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.7e-08, Aligned region: 2..60
Protein Sequence: 77 a.a.     [Download]
>gi|56416413|ref|YP_153487.1| hypothetical protein AM063 [Anaplasma marginale str. St. Maries]
MVALIWLFITAGSTNADTISSTNTADDTATKVICDVIVFVQKLGLPIMTGVVLGSGVMAWHTCMACYCNA
GCVYSHR
 
Nucleotide Sequence: 234 bp     [Download]
>gi|56416370|ref|NC_004842.2|:47834-48067 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGGTAGCCCTGATATGGTTATTCATCACAGCAGGTTCTACTAATGCCGATACTATCAGCAGTACTAACA
CTGCTGACGATACAGCTACCAAGGTTATTTGTGACGTCATTGTCTTCGTGCAGAAGCTGGGATTACCCAT
CATGACAGGGGTGGTACTAGGTTCTGGCGTCATGGCTTGGCACACTTGCATGGCCTGCTATTGTAATGCT
GGTTGTGTGTACAGCCATAGGTAA
 Primer design