SecReT4
Protein ID: 56416414
T4SS name [ID]VirB [496]
Gene symbolorfX
Locus tagAM065
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]48140..48535 [+]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5PBU6
KEGG IDama:AM065
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5.2e-19, Aligned region: 7..104
Protein Sequence: 131 a.a.     [Download]
>gi|56416414|ref|YP_153488.1| hypothetical protein AM065 [Anaplasma marginale str. St. Maries]
MLLKLRFLLIAVVLALGILHGVPAAGATGAQASPSPSTEADDTATVVICNVIRFVQKLGLPIMTGVILGS
SIMAIFGKLAWPAIVMLVVFTAIFFGAGKLMAKFAAGLSGEGVKDADKFDCASHTGQGGRT
 
Nucleotide Sequence: 396 bp     [Download]
>gi|56416370|ref|NC_004842.2|:48140-48535 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTGCTAAAACTTAGATTCTTACTCATTGCTGTAGTATTAGCATTGGGTATCTTACATGGTGTACCTG
CTGCAGGGGCTACTGGTGCTCAGGCGAGCCCTAGTCCCAGTACTGAAGCTGATGATACAGCGACTGTTGT
TATATGTAACGTTATACGGTTTGTGCAGAAGCTGGGACTACCTATCATGACTGGGGTGATATTGGGTTCT
AGCATTATGGCCATCTTTGGTAAGCTTGCATGGCCTGCTATTGTGATGTTGGTTGTATTTACAGCGATAT
TCTTTGGTGCTGGTAAGCTTATGGCTAAATTTGCTGCCGGACTTAGTGGTGAAGGTGTGAAGGATGCCGA
TAAGTTTGACTGTGCCAGTCATACTGGGCAAGGAGGCCGGACTTAG
 Primer design