SecReT4
Protein ID: 56416422
T4SS name [ID]VirB [496]
Gene symbolorfX
Locus tagAM077
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]64841..65242 [-]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5PBT8
KEGG IDama:AM077
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.9e-19, Aligned region: 6..103
Protein Sequence: 133 a.a.     [Download]
>gi|56416422|ref|YP_153496.1| hypothetical protein AM077 [Anaplasma marginale str. St. Maries]
MLLKLRFLLIAGVLALGILHGVPAGAAAQASPSTTGTEADDTATVVICNVIRFVQKLGLPIMTGVILGSS
IMAIFGKLAWPAIVMLVVFTAIFFGAGKLMAKFAKGLSGDGIGDASKFDCSQHTAVNTSQSNR
 
Nucleotide Sequence: 402 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c65242-64841 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTGCTAAAACTTAGATTCTTACTCATTGCTGGAGTATTAGCATTGGGTATCTTACATGGTGTACCTG
CAGGGGCTGCTGCTCAGGCGAGCCCTAGTACTACTGGTACTGAAGCTGATGATACAGCGACTGTTGTTAT
ATGCAATGTTATACGGTTTGTGCAGAAGCTGGGACTACCCATCATGACTGGGGTGATACTAGGTTCTAGC
ATTATGGCTATCTTTGGTAAGCTTGCATGGCCTGCTATTGTAATGCTGGTTGTATTTACAGCTATATTCT
TTGGTGCTGGTAAGCTCATGGCTAAATTTGCTAAGGGGTTGAGTGGTGATGGCATAGGTGATGCCAGTAA
GTTTGACTGTTCACAGCATACAGCGGTCAACACCAGCCAAAGTAACCGATAG
 Primer design