SecReT4
Protein ID: 56416423
T4SS name [ID]VirB [496]
Gene symbolorfX
Locus tagAM082
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]67571..67978 [+]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5PBT7
KEGG IDama:AM082
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.5e-17, Aligned region: 27..107
Protein Sequence: 135 a.a.     [Download]
>gi|56416423|ref|YP_153497.1| hypothetical protein AM082 [Anaplasma marginale str. St. Maries]
MLLKLRFLLIAVVLALGILHGVPAAGAAAGAASGSSAGTTQAADDTATVVICNVIRFVQKLGLPIMTGVI
LGSSIMAIFGKLAWPAIVMLVVFTAIFFGAGKLMAKFAKGVGDVGGKSAESFDCSQHTAVNTKQS
 
Nucleotide Sequence: 408 bp     [Download]
>gi|56416370|ref|NC_004842.2|:67571-67978 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTGCTAAAACTTAGATTCTTACTAATTGCTGTAGTATTAGCATTGGGTATCTTACATGGTGTACCTG
CTGCAGGGGCTGCTGCAGGGGCTGCTAGCGGTAGCAGTGCAGGGACTACTCAGGCTGCTGACGATACAGC
GACTGTTGTTATATGTAACGTTATACGGTTTGTGCAGAAGCTGGGACTACCCATCATGACTGGAGTGATA
CTAGGTTCTAGCATTATGGCTATCTTTGGTAAGCTTGCATGGCCTGCTATTGTAATGCTGGTTGTATTTA
CAGCTATATTCTTTGGTGCTGGTAAGCTCATGGCTAAATTTGCCAAAGGTGTAGGTGATGTGGGAGGAAA
GAGCGCCGAGAGCTTTGACTGTTCACAGCATACAGCGGTCAACACCAAGCAAAGCTAA
 Primer design