SecReT4
Protein ID: 56416511
T4SS name [ID]VirB [496]
Gene symbolorfX
Locus tagAM210
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]175825..176214 [+]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5PBJ9
KEGG IDama:AM210
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 9.5e-20, Aligned region: 5..100
Protein Sequence: 129 a.a.     [Download]
>gi|56416511|ref|YP_153585.1| hypothetical protein AM210 [Anaplasma marginale str. St. Maries]
MLLKLRFLLIAVVLAFGILHGVPAGASKSSEGAQTADDTATIVICNVIGFVQKLGLPIMTGVILGSSIMA
IFGKLAWPAIVMLVVFTAIFFGAGKLMAKFAAGLGDVGGGTDASKFDCASHKGSSGAAG
 
Nucleotide Sequence: 390 bp     [Download]
>gi|56416370|ref|NC_004842.2|:175825-176214 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTGCTAAAACTTAGATTCTTACTCATTGCTGTAGTATTAGCATTTGGTATCTTACATGGTGTACCTG
CTGGGGCTAGTAAGTCCAGCGAGGGTGCTCAGACTGCTGATGATACAGCGACTATTGTTATATGTAATGT
TATAGGGTTTGTACAGAAGCTGGGACTACCCATCATGACTGGGGTGATACTAGGTTCTAGCATTATGGCT
ATCTTTGGTAAGCTTGCATGGCCTGCTATTGTGATGTTGGTTGTATTTACAGCTATATTCTTTGGTGCTG
GTAAGCTTATGGCTAAGTTTGCTGCTGGATTGGGCGATGTGGGAGGAGGAACGGATGCCAGTAAGTTTGA
CTGTGCCAGTCATAAAGGTAGCAGTGGTGCTGCTGGGTAG
 Primer design