SecReT4
Protein ID: 56416578
T4SS name [ID]VirB [496]
Gene symbol-
Locus tagAM306
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]259077..259331 [-]
Producthypothetical protein
Component typeVirB7
UniProt IDQ5PBD2
KEGG IDama:AM306
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 84 a.a.     [Download]
>gi|56416578|ref|YP_153652.1| hypothetical protein AM306 [Anaplasma marginale str. St. Maries]
MRTVCFWLAWRVAQREGSLASRWVFVVVCMRFSRVVLLLLVAACGLQGCGGLFSKGERRIKSPCVRASGS
QTCERHPVNQWWLG
 
Nucleotide Sequence: 255 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c259331-259077 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGCGGACCGTTTGTTTTTGGCTTGCATGGCGCGTGGCCCAGCGTGAGGGGTCTCTCGCCTCTCGGTGGG
TTTTTGTGGTGGTTTGTATGAGATTTTCTAGGGTGGTGCTCCTTTTGCTTGTTGCTGCGTGCGGGTTGCA
GGGATGCGGCGGTCTGTTTTCCAAGGGAGAGCGCAGGATTAAGAGTCCTTGTGTCAGGGCTAGTGGCAGC
CAGACGTGTGAACGCCACCCAGTAAACCAGTGGTGGCTTGGGTGA
 Primer design