SecReT4
Protein ID: 56416859
T4SS name [ID]VirB [496]
Gene symbolorfX
Locus tagAM717
StrainAnaplasma marginale str. St. Maries
Repliconchromosome [GenBank: NC_004842] [Browse all T4SS(s) in this replicon]
Location [Strand]659399..659770 [-]
Producthypothetical protein
Component typeVirB2
UniProt IDQ5PAK2
KEGG IDama:AM717
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.9e-20, Aligned region: 5..95
Protein Sequence: 123 a.a.     [Download]
>gi|56416859|ref|YP_153933.1| hypothetical protein AM717 [Anaplasma marginale str. St. Maries]
MLLKLRFLLIAGVLAFGILHGVPAGAEAAKDDDTATVVICNVIRFVQKLGLPIMTGVILGSSIMAIFGKL
AWPAIVMLVVFTAIFFGAGKLMAKFAKGLGGENENFDCAQHTAVNSSPKPAKP
 
Nucleotide Sequence: 372 bp     [Download]
>gi|56416370|ref|NC_004842.2|:c659770-659399 Anaplasma marginale str. St. Maries chromosome, complete genome
ATGTTGCTAAAACTTAGATTCTTACTCATTGCTGGAGTATTAGCATTTGGTATCTTACATGGTGTACCTG
CTGGGGCTGAGGCTGCTAAGGATGATGATACAGCGACTGTTGTTATATGTAACGTTATACGGTTTGTGCA
GAAGCTGGGACTACCCATCATGACTGGAGTGATACTAGGTTCTAGCATTATGGCTATCTTTGGTAAGCTT
GCATGGCCTGCTATTGTAATGTTGGTTGTATTTACAGCTATATTCTTTGGTGCTGGTAAGCTTATGGCTA
AGTTTGCTAAGGGGTTGGGTGGCGAAAATGAGAACTTCGACTGTGCACAGCATACAGCAGTCAACAGCAG
CCCCAAGCCAGCCAAGCCCTAA
 Primer design